BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0538 (615 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation facto... 35 5e-04 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 1.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 1.2 AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 21 6.2 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 6.2 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 21 6.2 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 21 6.2 >AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation factor 1-alpha protein. Length = 56 Score = 35.1 bits (77), Expect = 5e-04 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 2 KSVEMHHEALQEAVPG 49 KSVEMHHEAL EAVPG Sbjct: 41 KSVEMHHEALPEAVPG 56 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +2 Query: 329 QPLSTWYLPSLYV*SPS---RNSHPSVVLLSVT 418 Q ++W+ PS+Y SP R+ +PS + +S + Sbjct: 183 QVAASWHTPSMYPLSPGAGFRSPYPSALPISTS 215 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +2 Query: 329 QPLSTWYLPSLYV*SPS---RNSHPSVVLLSVT 418 Q ++W+ PS+Y SP R+ +PS + +S + Sbjct: 75 QVAASWHTPSMYPLSPGAGFRSPYPSALPISTS 107 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 542 TIFHTTAILH 571 T++HTTA LH Sbjct: 155 TLYHTTAYLH 164 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 6.2 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = -2 Query: 317 LMDFGLTSVDLPVRRSTFSLILQICRQCGQCGNPRLVCNRLRFD 186 L+ F +TSV + V + + IC +C + L FD Sbjct: 714 LLLFKITSVMIAVSGLVYIATVWICTLMNRCKFSEFMTKLLEFD 757 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 542 TIFHTTAILH 571 T++HTTA LH Sbjct: 155 TLYHTTAYLH 164 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 542 TIFHTTAILH 571 T++HTTA LH Sbjct: 155 TLYHTTAYLH 164 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,548 Number of Sequences: 336 Number of extensions: 3160 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -