BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0537 (548 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0315 + 20803035-20803154,20803235-20804089,20804171-208043... 29 2.4 05_05_0079 + 22239238-22239395,22240837-22240877,22240955-222410... 28 5.6 >01_05_0315 + 20803035-20803154,20803235-20804089,20804171-20804350, 20805191-20805286,20805895-20806179 Length = 511 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 480 TIRYGVEEVTVADISQEESNRNIILHEPNQXXKSA 376 T R G ++T ADI ++ R++I+H P K A Sbjct: 410 TGRQGQRQMTCADICEDPPARDVIIHRPYYNLKRA 444 >05_05_0079 + 22239238-22239395,22240837-22240877,22240955-22241033, 22241570-22241656,22241749-22241837,22241933-22242004, 22242094-22242186,22242339-22242427 Length = 235 Score = 27.9 bits (59), Expect = 5.6 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -3 Query: 294 PLTSFRMGRMMTSRSIYLCSRSKQNYMIHFSHI 196 P+T GR + RSI++C R + +++ FS + Sbjct: 120 PITPVLRGRPSSKRSIHICGRPRWLFVLLFSAV 152 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,462,231 Number of Sequences: 37544 Number of extensions: 187735 Number of successful extensions: 238 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 238 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -