BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0537 (548 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z35663-10|CAA84731.1| 278|Caenorhabditis elegans Hypothetical p... 29 1.7 AF043699-4|AAB97568.1| 610|Caenorhabditis elegans Serotonin/oct... 27 8.9 >Z35663-10|CAA84731.1| 278|Caenorhabditis elegans Hypothetical protein T04A8.12 protein. Length = 278 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 404 CSIIFRLLSSWLISATVTSSTPYLIVTVHSYEV 502 CSII+ LLS+WL + T + L H Y++ Sbjct: 165 CSIIYMLLSTWLFNETGRRTATNLGQRSHEYKI 197 >AF043699-4|AAB97568.1| 610|Caenorhabditis elegans Serotonin/octopamine receptor familyprotein 3 protein. Length = 610 Score = 27.1 bits (57), Expect = 8.9 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +3 Query: 195 KYVRSESYNSV*IESTNILNVMSSFYPS*NSLMESVWKYE*NITSNTPS 341 KY + SYNS I STN +N + + ++ K +T NTP+ Sbjct: 561 KYTNNNSYNSTAIRSTNAVNRVPQTSLGNYTQTQNSEKSSAAVTFNTPT 609 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,771,198 Number of Sequences: 27780 Number of extensions: 195492 Number of successful extensions: 299 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 299 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -