BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0536 (619 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 55 4e-10 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 55 4e-10 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 52 3e-09 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 52 4e-09 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 22 4.7 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 6.3 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 55.2 bits (127), Expect = 4e-10 Identities = 21/51 (41%), Positives = 33/51 (64%) Frame = +2 Query: 353 LYDPRDVEVILSSHVYIDKAEEYRFFKPWLGNGLLISTGQKWRSHRKLIAP 505 + P D E++LS+ +++K+ Y WLG GLL STG KW++ RK++ P Sbjct: 89 ILSPEDCELVLSNPTHMEKSAIYNLLHDWLGTGLLTSTGLKWQTRRKILTP 139 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 55.2 bits (127), Expect = 4e-10 Identities = 21/51 (41%), Positives = 33/51 (64%) Frame = +2 Query: 353 LYDPRDVEVILSSHVYIDKAEEYRFFKPWLGNGLLISTGQKWRSHRKLIAP 505 + P D E++LS+ +++K+ Y WLG GLL STG KW++ RK++ P Sbjct: 89 ILSPEDCELVLSNPTHMEKSAIYNLLHDWLGTGLLTSTGLKWQTRRKILTP 139 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 52.4 bits (120), Expect = 3e-09 Identities = 23/53 (43%), Positives = 32/53 (60%) Frame = +2 Query: 347 VFLYDPRDVEVILSSHVYIDKAEEYRFFKPWLGNGLLISTGQKWRSHRKLIAP 505 V L +P DVE++L+ K+ Y F WLG GLL S G KW++ RK++ P Sbjct: 80 VNLLNPEDVELVLTDTKQNTKSFIYHFLHSWLGTGLLTSAGPKWQNRRKILTP 132 Score = 28.3 bits (60), Expect = 0.055 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 502 PHIHLNVLKSFIDLFNANSRAVVXKLK 582 P H N+L+ FI +FN ++ +V L+ Sbjct: 132 PAFHFNILQEFIQIFNEETKRLVEDLE 158 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 52.0 bits (119), Expect = 4e-09 Identities = 23/53 (43%), Positives = 32/53 (60%) Frame = +2 Query: 347 VFLYDPRDVEVILSSHVYIDKAEEYRFFKPWLGNGLLISTGQKWRSHRKLIAP 505 V L +P DVE++L+ K+ Y F WLG GLL S G KW++ RK++ P Sbjct: 80 VNLLNPEDVELVLTDTKQNTKSFIYHFLHSWLGTGLLTSRGPKWQNRRKILTP 132 Score = 28.3 bits (60), Expect = 0.055 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 502 PHIHLNVLKSFIDLFNANSRAVVXKLK 582 P H N+L+ FI +FN ++ +V L+ Sbjct: 132 PAFHFNILQEFIQIFNEETKRLVEDLE 158 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.8 bits (44), Expect = 4.7 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 431 KPWLGNGLLISTGQKWRSHRKLIAP 505 +P L L G+KW+ R ++P Sbjct: 69 EPLLSEALTNLPGEKWKEMRATLSP 93 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.4 bits (43), Expect = 6.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 282 FRKALTTITNPSLRSG 329 FR+ L NPSLR G Sbjct: 23 FRRGLRLHDNPSLREG 38 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,620 Number of Sequences: 336 Number of extensions: 2692 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -