BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0533 (608 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ973472-1|CAJ01519.1| 168|Anopheles gambiae hypothetical prote... 25 2.5 AJ697732-1|CAG26925.1| 168|Anopheles gambiae putative chemosens... 25 2.5 >AJ973472-1|CAJ01519.1| 168|Anopheles gambiae hypothetical protein protein. Length = 168 Score = 24.6 bits (51), Expect = 2.5 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 584 SNKTGDYKHDRSRDVTLRYIFFKQNMHSNIMHCLRN*G 471 +N+T K+D ++ L IF + + N M+CL+N G Sbjct: 19 ANETYVTKYD---NIDLEEIFSSKRLMDNYMNCLKNVG 53 >AJ697732-1|CAG26925.1| 168|Anopheles gambiae putative chemosensory protein CSP3 protein. Length = 168 Score = 24.6 bits (51), Expect = 2.5 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 584 SNKTGDYKHDRSRDVTLRYIFFKQNMHSNIMHCLRN*G 471 +N+T K+D ++ L IF + + N M+CL+N G Sbjct: 19 ANETYVTKYD---NIDLEEIFSSKRLMDNYMNCLKNVG 53 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 619,021 Number of Sequences: 2352 Number of extensions: 12624 Number of successful extensions: 58 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -