BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0533 (608 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011439-1|AAR99097.1| 722|Drosophila melanogaster RE60277p pro... 28 8.7 AE013599-994|AAF58858.1| 722|Drosophila melanogaster CG18445-PA... 28 8.7 >BT011439-1|AAR99097.1| 722|Drosophila melanogaster RE60277p protein. Length = 722 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 Query: 65 RHLYKMASEYSYSIKCYTQLCIHELYLKIIC*IVQFTQLDPKNI*RLI 208 RH + ++ ++ C+ Q IH L IC IV TQ DP+ + R + Sbjct: 63 RHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQ-DPRIVQRAV 109 >AE013599-994|AAF58858.1| 722|Drosophila melanogaster CG18445-PA protein. Length = 722 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 Query: 65 RHLYKMASEYSYSIKCYTQLCIHELYLKIIC*IVQFTQLDPKNI*RLI 208 RH + ++ ++ C+ Q IH L IC IV TQ DP+ + R + Sbjct: 63 RHTFALSIGLAFGYFCFGQQAIHIAGLPAICYIVIRTQ-DPRIVQRAV 109 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,684,381 Number of Sequences: 53049 Number of extensions: 471890 Number of successful extensions: 980 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 980 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2503659279 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -