BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0528 (415 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 1.8 U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. 22 2.4 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 3.2 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 4.2 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 21 4.2 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 21 4.2 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 5.5 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 5.5 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 5.5 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 5.5 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 5.5 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 5.5 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 5.5 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 5.5 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 5.5 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 5.5 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 5.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 5.5 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 5.5 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 5.5 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 5.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 5.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 5.5 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 5.5 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 5.5 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 20 9.6 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 20 9.6 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 20 9.6 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 20 9.6 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.6 bits (46), Expect = 1.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 191 EKRAMELLKVSKDKRALKFLKHDWAHTSA 277 EK E K + +L+ HD+ HTS+ Sbjct: 201 EKSGNESKKYATSSNSLRSRTHDFQHTSS 229 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. Length = 53 Score = 22.2 bits (45), Expect = 2.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 31 PAKRPQNN*NIRWPQGY 81 P + P N I+WPQGY Sbjct: 38 PGQGPFNP-KIKWPQGY 53 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 3.2 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 116 LKGLQT-KHSKFVRDLVREVVGHAQYEKRAME 208 +K ++T K FV V EV+ + + EKR E Sbjct: 510 VKTMKTIKKGSFVTQYVGEVITNEEAEKRGKE 541 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 4.2 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPLFEREEIKNVLTKINK 188 Score = 20.6 bits (41), Expect = 7.3 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 191 EKRAMELLKVSKDKRALKFLKHDWAHTSA 277 +K E K + +L+ HD+ HTS+ Sbjct: 201 KKSGNESKKYATSSNSLRNRTHDFQHTSS 229 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 21.4 bits (43), Expect = 4.2 Identities = 11/41 (26%), Positives = 16/41 (39%) Frame = +2 Query: 122 GLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALK 244 GLQ K D + + YEKR+ + V + K Sbjct: 213 GLQRKKDTTFDDYLDYAINPFDYEKRSTDFQDVESGSESFK 253 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 21.4 bits (43), Expect = 4.2 Identities = 11/41 (26%), Positives = 16/41 (39%) Frame = +2 Query: 122 GLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALK 244 GLQ K D + + YEKR+ + V + K Sbjct: 213 GLQRKKDTTFDDYLDYAINPFDYEKRSTDFQDVESGSESFK 253 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 150 ILIRRTGEGSKPIFEREEIKNVLTKINK 177 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 150 ILIRRTGEGSKPIFEREEIKNVLTKINK 177 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 150 ILIRRTGEGSKPIFEREEIKNVLTKINK 177 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 150 ILIRRTGEGSKPIFEREEIKNVLTKINK 177 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 166 ILIRRTGEGSKPIFEREEIKNVLTKINK 193 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.0 bits (42), Expect = 5.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 244 VLEARLGTHIRAKRKREELSNVLAQMRK 327 +L R G + +REE+ NVL ++ K Sbjct: 161 ILIRRTGEGSKPIFEREEIKNVLTKINK 188 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 20.2 bits (40), Expect = 9.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 256 RLGTHIRAKRKREELSNVLAQMRK 327 R G + +REE+ NVL ++ K Sbjct: 154 RTGEGSKPLFEREEIKNVLTKINK 177 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.2 bits (40), Expect = 9.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 256 RLGTHIRAKRKREELSNVLAQMRK 327 R G + +REE+ NVL ++ K Sbjct: 165 RTGEGSKPLFEREEIKNVLTKINK 188 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.2 bits (40), Expect = 9.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 256 RLGTHIRAKRKREELSNVLAQMRK 327 R G + +REE+ NVL ++ K Sbjct: 165 RTGEGSKPLFEREEIKNVLTKINK 188 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 20.2 bits (40), Expect = 9.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 256 RLGTHIRAKRKREELSNVLAQMRK 327 R G + +REE+ NVL ++ K Sbjct: 154 RTGEGSKPLFEREEIKNVLTKINK 177 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,286 Number of Sequences: 438 Number of extensions: 1698 Number of successful extensions: 31 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10503195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -