BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0527 (616 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY058640-1|AAL13869.1| 950|Drosophila melanogaster LD33980p pro... 28 8.7 AF197910-1|AAF15596.1| 1490|Drosophila melanogaster Numb-associa... 28 8.7 AE014134-3001|AAN11019.1| 950|Drosophila melanogaster CG10637-P... 28 8.7 AE014134-3000|AAF53727.2| 1488|Drosophila melanogaster CG10637-P... 28 8.7 >AY058640-1|AAL13869.1| 950|Drosophila melanogaster LD33980p protein. Length = 950 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 270 ELFSIEDYPQILKLEEYDPLQELHHLIHSKFP 365 +LF +E +PQ+++ E +P HH IH +FP Sbjct: 603 DLFGLEPFPQVIRTIEQNP---QHHQIH-QFP 630 >AF197910-1|AAF15596.1| 1490|Drosophila melanogaster Numb-associated kinase protein. Length = 1490 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 270 ELFSIEDYPQILKLEEYDPLQELHHLIHSKFP 365 +LF +E +PQ+++ E +P HH IH +FP Sbjct: 1141 DLFGLEPFPQVIRTIEQNP---QHHQIH-QFP 1168 >AE014134-3001|AAN11019.1| 950|Drosophila melanogaster CG10637-PB, isoform B protein. Length = 950 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 270 ELFSIEDYPQILKLEEYDPLQELHHLIHSKFP 365 +LF +E +PQ+++ E +P HH IH +FP Sbjct: 603 DLFGLEPFPQVIRTIEQNP---QHHQIH-QFP 630 >AE014134-3000|AAF53727.2| 1488|Drosophila melanogaster CG10637-PA, isoform A protein. Length = 1488 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 270 ELFSIEDYPQILKLEEYDPLQELHHLIHSKFP 365 +LF +E +PQ+++ E +P HH IH +FP Sbjct: 1141 DLFGLEPFPQVIRTIEQNP---QHHQIH-QFP 1168 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,231,990 Number of Sequences: 53049 Number of extensions: 286197 Number of successful extensions: 480 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2517878700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -