BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0525 (621 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces po... 31 0.18 SPBC1604.14c |shk1|pak1, orb2|PAK-related kinase Shk1|Schizosacc... 27 2.9 SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces p... 26 5.1 >SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 30.7 bits (66), Expect = 0.18 Identities = 32/112 (28%), Positives = 50/112 (44%), Gaps = 13/112 (11%) Frame = -1 Query: 531 VKWLLE-PQDIYNV------NAPPTSRYKF*GLKYNYNGCPIFQTETHYCFTAEI--GRV 379 + WLL+ P + V N P F ++ N G I + F I G V Sbjct: 141 ISWLLQLPDSVVGVTFLALGNGSPDILSTFAAVRVNSGGMAIGELLGSAFFIVAIVAGSV 200 Query: 378 --VVPTRADSQEVLPPV--IT*TIILRV*FLLHDVIPSPWKSIVNIVKYVFH 235 + P + + L V +T TI+L + F+LHD S W+S+V I+ Y+ + Sbjct: 201 CLIKPFKIPRRHFLRDVAFLTGTILLVIMFVLHDGSLSIWQSLVMILYYLLY 252 >SPBC1604.14c |shk1|pak1, orb2|PAK-related kinase Shk1|Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 26.6 bits (56), Expect = 2.9 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -2 Query: 269 SQS*TLLSTYFIRKIGTRLRDSNTVASLDTNASDILSFRPR 147 SQS T +S +G+R S+++ L TN SD+ S+ R Sbjct: 68 SQSRTTVSRV---SLGSRQHSSSSIRKLQTNVSDVRSYDER 105 >SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 2280 Score = 25.8 bits (54), Expect = 5.1 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = -3 Query: 391 NRQSGGTYPCGLTRGPTTSNYVNYNFAGLIFITRCYSFTVEVNREHC*VRISLEKL 224 +R S G+Y L T+ + GL+ + +S+TV E RIS++ L Sbjct: 645 SRSSPGSYHLFLNGSRCTAGVRSLTDGGLLVLLNGHSYTVYYRDEVTGTRISIDNL 700 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,428,954 Number of Sequences: 5004 Number of extensions: 48728 Number of successful extensions: 93 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -