BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0525 (621 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 26 0.84 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 5.9 >AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding protein AgamOBP41 protein. Length = 279 Score = 26.2 bits (55), Expect = 0.84 Identities = 13/49 (26%), Positives = 21/49 (42%) Frame = -1 Query: 525 WLLEPQDIYNVNAPPTSRYKF*GLKYNYNGCPIFQTETHYCFTAEIGRV 379 ++ +P D YNVN T + L+ N C E+ C+ G + Sbjct: 98 FVTDPADAYNVNRTETCLQELPALELNAEKCCGLAFESFLCYYYNYGNL 146 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.4 bits (48), Expect = 5.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 411 HYCFTAEIGRVVVPTRADSQEVLP 340 H F AEIG +V DS E+LP Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLP 962 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 638,301 Number of Sequences: 2352 Number of extensions: 12362 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -