BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0524 (629 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8GEF9 Cluster: Putative uncharacterized protein; n=1; ... 79 7e-14 UniRef50_A7BPF2 Cluster: LacZ alpha peptide; n=1; Beggiatoa sp. ... 58 1e-07 UniRef50_Q1E5X1 Cluster: Putative uncharacterized protein; n=1; ... 33 4.3 UniRef50_UPI00005A3933 Cluster: PREDICTED: hypothetical protein ... 33 5.7 UniRef50_A0D095 Cluster: Chromosome undetermined scaffold_33, wh... 33 7.5 UniRef50_Q1IW01 Cluster: Putative uncharacterized protein; n=1; ... 32 9.9 UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia sp... 32 9.9 >UniRef50_Q8GEF9 Cluster: Putative uncharacterized protein; n=1; Erwinia amylovora|Rep: Putative uncharacterized protein - Erwinia amylovora (Fire blight bacteria) Length = 99 Score = 79.4 bits (187), Expect = 7e-14 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +2 Query: 509 SGKCARNPYLFIFLNTFKYVSAHETITLINASIILKRK 622 SGKCARNPYLFIFLNTFKYVSAHETITLINASIILK++ Sbjct: 27 SGKCARNPYLFIFLNTFKYVSAHETITLINASIILKKE 64 >UniRef50_A7BPF2 Cluster: LacZ alpha peptide; n=1; Beggiatoa sp. SS|Rep: LacZ alpha peptide - Beggiatoa sp. SS Length = 73 Score = 58.4 bits (135), Expect = 1e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 358 RQALNRGLPLGFRFSALRHLDPKKLD 281 RQALNRGLPLGFRFSALRHLDPKKLD Sbjct: 48 RQALNRGLPLGFRFSALRHLDPKKLD 73 Score = 46.4 bits (105), Expect = 6e-04 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -1 Query: 497 DAPCSGALSAAGVVVTRSVTRYTCQRPSARSFRFLP 390 DAPCSGALSAAGVVVTRSVT + F F P Sbjct: 2 DAPCSGALSAAGVVVTRSVTATLASALAPAPFAFFP 37 >UniRef50_Q1E5X1 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 682 Score = 33.5 bits (73), Expect = 4.3 Identities = 28/81 (34%), Positives = 34/81 (41%), Gaps = 2/81 (2%) Frame = -1 Query: 533 RGSAHISPKVPPDAPCSGALSAAGVVVT--RSVTRYTCQRPSARSFRFLPXLSRHVRRLS 360 RG P PP AP S A SAAG V + YT Q P R R P + H R Sbjct: 418 RGPLPAGPMAPPPAPPSVA-SAAGAVPQPLAQPSPYTPQHPQFRENRPTPTIPMHQPR-- 474 Query: 359 PSSSKSGAPFRVPI*CFTAPR 297 P + S A P+ + P+ Sbjct: 475 PQKTVSVADIESPMSLYNPPQ 495 >UniRef50_UPI00005A3933 Cluster: PREDICTED: hypothetical protein XP_859466; n=1; Canis lupus familiaris|Rep: PREDICTED: hypothetical protein XP_859466 - Canis familiaris Length = 296 Score = 33.1 bits (72), Expect = 5.7 Identities = 23/57 (40%), Positives = 28/57 (49%) Frame = -1 Query: 503 PPDAPCSGALSAAGVVVTRSVTRYTCQRPSARSFRFLPXLSRHVRRLSPSSSKSGAP 333 PPD PC+ ALS+A RS R R R+ F L+R +RR P S S P Sbjct: 5 PPDLPCAQALSSAR---PRSPRRRPSSRQRDRAGGF---LTRRLRRARPGGSLSSGP 55 >UniRef50_A0D095 Cluster: Chromosome undetermined scaffold_33, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_33, whole genome shotgun sequence - Paramecium tetraurelia Length = 1173 Score = 32.7 bits (71), Expect = 7.5 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -1 Query: 155 VYSFDL*GILPISAYWLKNELI*QKFNANFNKILTLTI 42 +++F L G L +WLKN+ KF++ F ++L L + Sbjct: 665 IFNFSLQGALSYIDFWLKNQHFDDKFSSTFTQLLLLAL 702 >UniRef50_Q1IW01 Cluster: Putative uncharacterized protein; n=1; Deinococcus geothermalis DSM 11300|Rep: Putative uncharacterized protein - Deinococcus geothermalis (strain DSM 11300) Length = 171 Score = 32.3 bits (70), Expect = 9.9 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +3 Query: 168 ECCSSLEQESTIKERGLQRQRAKNRLSGRGPLREPSP*SSFLGSRCRKA 314 E SS S +++R +QR+ G PL +PS S LG CR+A Sbjct: 32 EVLSSHSHSSGLQDRPVQRRSESPSRDGLLPLNKPSRESRLLGRACRQA 80 >UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia spumigena CCY 9414|Rep: Beta-D-galactosidase - Nodularia spumigena CCY 9414 Length = 72 Score = 32.3 bits (70), Expect = 9.9 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +1 Query: 1 RPSQQLRSXNGEWQIV 48 RPSQQLRS NGEW+++ Sbjct: 57 RPSQQLRSLNGEWRLM 72 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 570,792,649 Number of Sequences: 1657284 Number of extensions: 10923592 Number of successful extensions: 24167 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 23471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24158 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 46466611856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -