BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0523 (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. 26 0.85 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 1.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 1.5 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 6.0 DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 23 7.9 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 7.9 >DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. Length = 353 Score = 26.2 bits (55), Expect = 0.85 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 213 EYKVNNSFF*FTNNCPKVRLPALIIVXSDVLR 118 EY++N+S + N+ ++ PA I DVLR Sbjct: 144 EYQLNDSAAYYLNSLDRISQPAYIPTQQDVLR 175 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.4 bits (53), Expect = 1.5 Identities = 7/20 (35%), Positives = 16/20 (80%) Frame = -3 Query: 426 VRYKRLDESSIIKGGNLCIW 367 +R++++ ES+++KGG +W Sbjct: 149 IRFEQMQESAVLKGGPRPLW 168 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.4 bits (53), Expect = 1.5 Identities = 7/20 (35%), Positives = 16/20 (80%) Frame = -3 Query: 426 VRYKRLDESSIIKGGNLCIW 367 +R++++ ES+++KGG +W Sbjct: 149 IRFEQMQESAVLKGGPRPLW 168 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.4 bits (48), Expect = 6.0 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -3 Query: 84 AIKLEINPKDKIDMQVVKAF 25 ++ L N +DK+D+ ++KAF Sbjct: 502 SVGLSTNDRDKLDLLLLKAF 521 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 23.0 bits (47), Expect = 7.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 384 GNLCIWTKKC 355 G CIW KKC Sbjct: 84 GGSCIWAKKC 93 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = -3 Query: 426 VRYKRLDESSIIKGGNLCIWTKKCY*YVNTD*FEYNR 316 VR+ + DE + + G+L +W YV+ + + +N+ Sbjct: 806 VRHSQSDEVPVCEPGHLKLWDGYSLLYVDGNDYPHNQ 842 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,313 Number of Sequences: 2352 Number of extensions: 9619 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -