BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0523 (617 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY095061-1|AAM11389.1| 1158|Drosophila melanogaster LP03070p pro... 30 2.9 AF236106-1|AAF36990.1| 1701|Drosophila melanogaster receptor pro... 30 2.9 AE013599-2319|AAF57973.1| 1701|Drosophila melanogaster CG8250-PA... 30 2.9 >AY095061-1|AAM11389.1| 1158|Drosophila melanogaster LP03070p protein. Length = 1158 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = -3 Query: 588 YICIVTIIYVFYNVRTQIKSFPNKST*YVFKDIQILYNLSQQIASDSSQLSQFNVRY 418 +ICI +I++ YN + K + V +D+Q L L I D S L+ FN Y Sbjct: 574 FICIAALIFMLYNRYQRKKQSKKRHKMLVEQDLQ-LTRLRNNI--DDSNLNNFNPNY 627 >AF236106-1|AAF36990.1| 1701|Drosophila melanogaster receptor protein tyrosine kinaseALK splice variant A protein. Length = 1701 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = -3 Query: 588 YICIVTIIYVFYNVRTQIKSFPNKST*YVFKDIQILYNLSQQIASDSSQLSQFNVRY 418 +ICI +I++ YN + K + V +D+Q L L I D S L+ FN Y Sbjct: 1117 FICIAALIFMLYNRYQRKKQSKKRHKMLVEQDLQ-LTRLRNNI--DDSNLNNFNPNY 1170 >AE013599-2319|AAF57973.1| 1701|Drosophila melanogaster CG8250-PA protein. Length = 1701 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = -3 Query: 588 YICIVTIIYVFYNVRTQIKSFPNKST*YVFKDIQILYNLSQQIASDSSQLSQFNVRY 418 +ICI +I++ YN + K + V +D+Q L L I D S L+ FN Y Sbjct: 1117 FICIAALIFMLYNRYQRKKQSKKRHKMLVEQDLQ-LTRLRNNI--DDSNLNNFNPNY 1170 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,790,298 Number of Sequences: 53049 Number of extensions: 405934 Number of successful extensions: 764 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 764 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2538517050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -