BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0522 (620 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0489 + 18269824-18270270,18271659-18271948,18272341-182725... 28 6.9 07_01_1182 + 11207282-11207330,11208015-11208094,11208181-112086... 28 6.9 >10_08_0489 + 18269824-18270270,18271659-18271948,18272341-18272512, 18272608-18272730,18272832-18272960,18273061-18273255, 18273384-18273470,18273563-18273835,18274047-18274154, 18274769-18275116 Length = 723 Score = 27.9 bits (59), Expect = 6.9 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +3 Query: 414 ATVITNLLSAIPYLGTILVN*I*GGFAVDNAT*-PDFTHFIFYYRSLF 554 A VI+N +SA+P+L IL+ I G P FTH++F+ L+ Sbjct: 496 AFVISNTISAMPFL--ILITFISGTMCYFMVRLHPGFTHYLFFVLCLY 541 >07_01_1182 + 11207282-11207330,11208015-11208094,11208181-11208645, 11213485-11213568,11213925-11214113,11214191-11214277, 11214343-11214969 Length = 526 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = +3 Query: 408 WGAT--VITNLLSAIPYLGTILV 470 +GAT VI+N LS+IPYLG I + Sbjct: 329 YGATEFVISNTLSSIPYLGLISI 351 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,792,455 Number of Sequences: 37544 Number of extensions: 191057 Number of successful extensions: 253 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 253 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -