BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0519 (608 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 27 0.63 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 24 4.4 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 26.6 bits (56), Expect = 0.63 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 398 QQMFTIDFHGEGTASYNNNETRKIIICVITG 490 QQ +I H EG RK ++C ITG Sbjct: 118 QQALSIVHHPEGVMGPTRRMIRKPLVCAITG 148 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -3 Query: 180 YTYLXVLNRSAERTAMRRRLHCKHTYRKGAICWCN 76 ++ L + + R+RL KHT+ + A +CN Sbjct: 125 FSKFMTLGKVRGKQTPRKRLRLKHTFAQEAKQFCN 159 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 657,161 Number of Sequences: 2352 Number of extensions: 13453 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -