BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0519 (608 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. 24 1.3 AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. 24 1.3 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 23 3.1 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 4.1 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 4.1 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 22 5.4 >AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. Length = 136 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 101 EKEPFVGVIGTHDR 60 EK P +G++GTH R Sbjct: 88 EKNPKLGILGTHGR 101 >AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. Length = 135 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 101 EKEPFVGVIGTHDR 60 EK P +G++GTH R Sbjct: 89 EKNPKLGILGTHGR 102 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 22.6 bits (46), Expect = 3.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 526 PIFCREAVMRFGLQGWGSC 582 PI CRE RF GSC Sbjct: 171 PIECRELTARFTTDVIGSC 189 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 4.1 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -1 Query: 137 RCVEGFIASTHIEKEPFVGVIGTHDRILRHVNE 39 RC +G + EKE ++G +D +R E Sbjct: 20 RCTQGKVNYREKEKEVLDNILGGYDARIRPSGE 52 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 4.1 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -1 Query: 137 RCVEGFIASTHIEKEPFVGVIGTHDRILRHVNE 39 RC +G + EKE ++G +D +R E Sbjct: 20 RCTQGKVNYREKEKEVLDNILGGYDARIRPSGE 52 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -2 Query: 517 DTYRARGPTTSNYANYNFSGFI 452 DT A P T+NY ++G + Sbjct: 349 DTVAAEWPATTNYLYLTYNGTV 370 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,362 Number of Sequences: 438 Number of extensions: 4451 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -