BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0518 (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0) 48 8e-06 SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_28811| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46540| Best HMM Match : RVT_1 (HMM E-Value=4.8e-27) 43 2e-04 SB_21429| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_8975| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_3054| Best HMM Match : RVT_1 (HMM E-Value=1.6e-09) 41 0.001 SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7810| Best HMM Match : RVT_1 (HMM E-Value=2.8026e-45) 41 0.001 SB_14434| Best HMM Match : RVT_1 (HMM E-Value=8e-34) 39 0.003 SB_18645| Best HMM Match : RVT_1 (HMM E-Value=0.0003) 39 0.003 SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44254| Best HMM Match : Rho_N (HMM E-Value=5.7) 38 0.007 SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.009 SB_54943| Best HMM Match : RWD (HMM E-Value=6.6) 38 0.009 SB_44297| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.009 SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.009 SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.009 SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.009 SB_53063| Best HMM Match : DUF359 (HMM E-Value=2.9) 38 0.009 SB_45779| Best HMM Match : RVT_1 (HMM E-Value=0) 37 0.011 SB_5450| Best HMM Match : eRF1_1 (HMM E-Value=2.6) 37 0.011 SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_58478| Best HMM Match : RVT_1 (HMM E-Value=1.3e-29) 36 0.026 SB_41639| Best HMM Match : Retrotrans_gag (HMM E-Value=6.6) 35 0.046 SB_36217| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.061 SB_51862| Best HMM Match : ETS_PEA3_N (HMM E-Value=5.5) 34 0.080 SB_41121| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 34 0.11 SB_40311| Best HMM Match : Bet_v_I (HMM E-Value=4.9) 34 0.11 SB_36295| Best HMM Match : Bet_v_I (HMM E-Value=4.9) 34 0.11 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_15517| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 34 0.11 SB_59142| Best HMM Match : RVT_1 (HMM E-Value=2.5e-09) 33 0.14 SB_44711| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_41742| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_34336| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 33 0.14 SB_32984| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 33 0.14 SB_26304| Best HMM Match : RVT_1 (HMM E-Value=2.3e-27) 33 0.14 SB_26129| Best HMM Match : RVT_1 (HMM E-Value=1.2e-27) 33 0.14 SB_25074| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_21933| Best HMM Match : RVT_1 (HMM E-Value=9.1e-27) 33 0.14 SB_15856| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) 33 0.14 SB_2480| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 33 0.14 SB_45059| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 33 0.14 SB_40291| Best HMM Match : RVT_1 (HMM E-Value=6e-28) 33 0.14 SB_31885| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) 33 0.14 SB_28694| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) 33 0.14 SB_28242| Best HMM Match : RVT_1 (HMM E-Value=2.2e-27) 33 0.14 SB_27583| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_25888| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 33 0.14 SB_22848| Best HMM Match : RVT_1 (HMM E-Value=5.1e-15) 33 0.14 SB_16416| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 33 0.14 SB_16379| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 33 0.14 SB_14764| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 33 0.14 SB_11034| Best HMM Match : Securin (HMM E-Value=6.8) 33 0.14 SB_10464| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_7494| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) 33 0.14 SB_3197| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_18177| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_154| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 33 0.19 SB_20817| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_4881| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_16234| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_35304| Best HMM Match : Kdo (HMM E-Value=1.1) 32 0.32 SB_53136| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) 32 0.43 SB_13241| Best HMM Match : RTP801_C (HMM E-Value=4) 32 0.43 SB_56418| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-35) 32 0.43 SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_2514| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_31097| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_25619| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_6770| Best HMM Match : Dehydrin (HMM E-Value=4.9) 31 0.75 SB_47653| Best HMM Match : zf-CCHC (HMM E-Value=0.0017) 31 0.75 SB_23305| Best HMM Match : RVT_1 (HMM E-Value=0.0013) 31 0.75 SB_17130| Best HMM Match : RVT_1 (HMM E-Value=0.0013) 31 0.75 SB_10776| Best HMM Match : RVT_1 (HMM E-Value=2e-27) 31 0.75 SB_1625| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_49941| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_43987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_59677| Best HMM Match : RVT_1 (HMM E-Value=2.1e-28) 30 1.3 SB_51339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_28907| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_7986| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_52232| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_45442| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_40823| Best HMM Match : rve (HMM E-Value=1.4e-12) 29 2.3 SB_38927| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_33701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_24668| Best HMM Match : RVT_1 (HMM E-Value=0.4) 29 2.3 SB_22716| Best HMM Match : zf-CCHC (HMM E-Value=0.0097) 29 2.3 SB_4272| Best HMM Match : RVT_1 (HMM E-Value=2e-28) 29 2.3 SB_1247| Best HMM Match : RVT_1 (HMM E-Value=4.6e-29) 29 2.3 SB_284| Best HMM Match : rve (HMM E-Value=0.001) 29 2.3 SB_54427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_53966| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) 29 2.3 SB_49245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_45583| Best HMM Match : RVT_1 (HMM E-Value=1.4e-05) 29 2.3 SB_45121| Best HMM Match : rve (HMM E-Value=3.8e-09) 29 2.3 SB_42130| Best HMM Match : rve (HMM E-Value=5.9e-13) 29 2.3 SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) 29 2.3 SB_12250| Best HMM Match : zf-CCHC (HMM E-Value=0.0097) 29 2.3 SB_8862| Best HMM Match : rve (HMM E-Value=3.3e-12) 29 2.3 SB_4914| Best HMM Match : RVT_1 (HMM E-Value=2.5e-16) 29 2.3 SB_1416| Best HMM Match : RVT_1 (HMM E-Value=1.8e-37) 29 3.0 SB_51031| Best HMM Match : RVT_1 (HMM E-Value=1.8e-37) 29 3.0 SB_56918| Best HMM Match : zf-CCHC (HMM E-Value=7.4e-07) 29 4.0 SB_56534| Best HMM Match : RVT_1 (HMM E-Value=5.5e-28) 29 4.0 SB_49535| Best HMM Match : RVT_1 (HMM E-Value=5.1e-32) 29 4.0 SB_41052| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_21980| Best HMM Match : RVT_1 (HMM E-Value=1.5e-35) 29 4.0 SB_19811| Best HMM Match : RVT_1 (HMM E-Value=3.5e-32) 29 4.0 SB_4361| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_3041| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_46816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_30012| Best HMM Match : Retrotrans_gag (HMM E-Value=1.1) 29 4.0 SB_13455| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_8133| Best HMM Match : RVT_1 (HMM E-Value=1.7e-34) 29 4.0 SB_6987| Best HMM Match : RVT_1 (HMM E-Value=2.2e-21) 29 4.0 SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_49131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_33569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_23070| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_2104| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_58972| Best HMM Match : RVT_1 (HMM E-Value=0.013) 28 5.3 SB_56248| Best HMM Match : RVT_1 (HMM E-Value=8.6e-20) 28 5.3 SB_55708| Best HMM Match : UPF0103 (HMM E-Value=0.87) 28 5.3 SB_43351| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_33095| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_19411| Best HMM Match : RVT_1 (HMM E-Value=1.1e-32) 28 5.3 SB_14926| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_11313| Best HMM Match : RVT_1 (HMM E-Value=2.1e-18) 28 5.3 SB_10860| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_51570| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_51205| Best HMM Match : RVT_1 (HMM E-Value=1.7e-21) 28 7.0 SB_50857| Best HMM Match : RVT_1 (HMM E-Value=9.8e-33) 28 7.0 SB_45933| Best HMM Match : RVT_1 (HMM E-Value=3.2e-13) 28 7.0 SB_35539| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07) 28 7.0 SB_8847| Best HMM Match : RVT_1 (HMM E-Value=5.5) 28 7.0 SB_31771| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_25232| Best HMM Match : RVT_1 (HMM E-Value=4.5e-09) 28 7.0 SB_21960| Best HMM Match : rve (HMM E-Value=4e-23) 28 7.0 SB_7045| Best HMM Match : rve (HMM E-Value=3.8e-22) 28 7.0 SB_28930| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) 27 9.2 SB_31348| Best HMM Match : ERM (HMM E-Value=0) 27 9.2 SB_28307| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_24991| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_20138| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) 27 9.2 >SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 2639 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/44 (52%), Positives = 28/44 (63%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 S SP+AAPV LA KK D R C+D+R LN + V + P PLI Sbjct: 697 SVSPWAAPVVLALKK--DNTMRFCVDYRKLNAVTVRDNYPLPLI 738 >SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1958 Score = 44.8 bits (101), Expect = 6e-05 Identities = 22/44 (50%), Positives = 28/44 (63%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 S SP+AAPV LA KK + R C+D+R LN + V + P PLI Sbjct: 1488 SVSPWAAPVVLALKKGNTM--RFCVDYRKLNAVTVRDNYPLPLI 1529 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/46 (50%), Positives = 27/46 (58%) Frame = +3 Query: 369 RGSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 R S SP+A+PV L KK D R+C+DFR LN V S P P I Sbjct: 428 RESNSPYASPVVLVRKK--DGALRVCVDFRQLNAKTVRDSYPIPRI 471 >SB_28811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 982 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/46 (50%), Positives = 27/46 (58%) Frame = +3 Query: 369 RGSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 R S SP+A+PV L KK D R+C+DFR LN V S P P I Sbjct: 336 RESNSPYASPVVLVRKK--DGALRVCVDFRQLNAKTVRDSYPIPRI 379 >SB_46540| Best HMM Match : RVT_1 (HMM E-Value=4.8e-27) Length = 751 Score = 42.7 bits (96), Expect = 2e-04 Identities = 23/48 (47%), Positives = 27/48 (56%) Frame = +3 Query: 363 FDRGSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 F S SP+A+PV L KK D R+C+DFR LN V S P P I Sbjct: 146 FQVESNSPYASPVVLVRKK--DGALRVCVDFRQLNAKTVRDSYPIPRI 191 >SB_21429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 S SPFA+PV L KK D R+C+DFR LN + S P + Sbjct: 684 SKSPFASPVVLVRKK--DNSLRVCVDFRRLNSKTIKDSYAIPRV 725 >SB_8975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1002 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/45 (40%), Positives = 28/45 (62%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 S SP+++P+ L KK D TR C+D+R N ++ PFP+I+ Sbjct: 346 SDSPWSSPIMLTKKK--DGNTRFCVDYRKSNDVIRKDLYPFPVID 388 >SB_3054| Best HMM Match : RVT_1 (HMM E-Value=1.6e-09) Length = 829 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 S SPFA+PV L KK D R+C+DFR LN + S P + Sbjct: 488 SKSPFASPVVLVRKK--DNSLRVCVDFRRLNSKTIKDSYAIPRV 529 >SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2028 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 S SPFA+PV L KK D R+C+DFR LN + S P + Sbjct: 404 SKSPFASPVVLVRKK--DNSLRVCVDFRRLNSKTIKDSYAIPRV 445 >SB_7810| Best HMM Match : RVT_1 (HMM E-Value=2.8026e-45) Length = 732 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 S SPFA+PV L KK D R+C+DFR LN + S P + Sbjct: 550 SKSPFASPVVLVRKK--DNSLRVCVDFRRLNSKTIKDSYAIPRV 591 >SB_14434| Best HMM Match : RVT_1 (HMM E-Value=8e-34) Length = 335 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/46 (47%), Positives = 26/46 (56%) Frame = +3 Query: 369 RGSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 R S SP+A+PV L KK D R+ +DFR LN V S P P I Sbjct: 59 RESNSPYASPVVLVRKK--DGALRVYVDFRQLNAKTVRDSYPIPRI 102 >SB_18645| Best HMM Match : RVT_1 (HMM E-Value=0.0003) Length = 1205 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/44 (43%), Positives = 24/44 (54%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 S SPFA+PV KK D R+C+DFR LN + S P + Sbjct: 511 SKSPFASPVVFVRKK--DNSLRVCVDFRRLNSKTIKDSYAIPRV 552 >SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1436 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 S S +++P+ K+ D RLCID+R LN +P PFP I+ Sbjct: 503 SKSAYSSPMVCVRKR--DGSLRLCIDYRQLNSKTLPDRQPFPKIQ 545 >SB_44254| Best HMM Match : Rho_N (HMM E-Value=5.7) Length = 209 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +3 Query: 333 KSNIEATTEK-FDRGSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 K+NIE + + R + S ++ P+ KK + RLCIDFR+LN+ + P P ++ Sbjct: 112 KANIEDLVNRDWIRKTKSQYSPPIVCVRKKSGE--LRLCIDFRELNRKSIADRHPIPRVQ 169 >SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 2353 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 S S +++P K+ D RLCID+R+LN+ VP P P I+ Sbjct: 999 SKSSYSSPAVCVRKR--DGSLRLCIDYRELNRKSVPDRFPIPRIQ 1041 >SB_54943| Best HMM Match : RWD (HMM E-Value=6.6) Length = 245 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 S S +++P K+ D RLCID+R+LN+ VP P P I+ Sbjct: 111 SKSSYSSPAVCVRKR--DGSLRLCIDYRELNRKSVPDRFPIPRIQ 153 >SB_44297| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 824 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 S S +++P K+ D RLCID+R+LN+ VP P P I+ Sbjct: 462 SKSSYSSPAVCVRKR--DGSLRLCIDYRELNRKSVPDRFPIPRIQ 504 >SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1020 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 S S +++P K+ D RLCID+R+LN+ VP P P I+ Sbjct: 62 SKSSYSSPAVCVRKR--DGSLRLCIDYRELNRKSVPDRFPIPRIQ 104 >SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1387 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 S S +++P K+ D RLCID+R+LN+ VP P P I+ Sbjct: 155 SKSSYSSPAVCVRKR--DGSLRLCIDYRELNRKSVPDRFPIPRIQ 197 >SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1623 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 S S +++P K+ D RLCID+R+LN+ VP P P I+ Sbjct: 930 SKSSYSSPAVCVRKR--DGSLRLCIDYRELNRKSVPDRFPIPRIQ 972 >SB_53063| Best HMM Match : DUF359 (HMM E-Value=2.9) Length = 378 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 S S +++P K+ D RLCID+R+LN+ VP P P I+ Sbjct: 244 SKSSYSSPAVCVRKR--DGSLRLCIDYRELNRKSVPDRFPIPRIQ 286 >SB_45779| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 946 Score = 37.1 bits (82), Expect = 0.011 Identities = 20/59 (33%), Positives = 31/59 (52%) Frame = +3 Query: 333 KSNIEATTEKFDRGSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 ++N + T+ R S S +A+P+ L KK RLC+D+R LN + P P I+ Sbjct: 45 RANAKLTSCGVIRPSQSDYASPIVLVRKKSG--ALRLCVDYRQLNAKTRKDAYPLPRID 101 >SB_5450| Best HMM Match : eRF1_1 (HMM E-Value=2.6) Length = 322 Score = 37.1 bits (82), Expect = 0.011 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLN 467 S SPFA+PV L KK D R+C+DFR LN Sbjct: 293 SKSPFASPVVLVRKK--DNSLRVCVDFRRLN 321 >SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 36.3 bits (80), Expect = 0.020 Identities = 19/44 (43%), Positives = 24/44 (54%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 S S +A+PV L K D R C+D+R LN + S P PLI Sbjct: 281 STSAWASPVVLVAKP--DGSMRFCVDYRKLNAVTRRDSFPLPLI 322 Score = 34.7 bits (76), Expect = 0.061 Identities = 29/112 (25%), Positives = 47/112 (41%), Gaps = 2/112 (1%) Frame = +1 Query: 289 KRPYTCTIEDRTEIESQISKLLQKNLIEGLTARXXXXXXXHIRK--KMIKKQDYA*ISEI 462 +RPY T E R EI+ Q++++L+ N+I+ T+ + M DY ++ + Sbjct: 252 QRPYRTTPEKREEIDKQVTEMLRNNIIQPSTSAWASPVVLVAKPDGSMRFCVDYRKLNAV 311 Query: 463 *TK**FXXXXXXXXXXXXDQNSKL*VLFSLDINSAFWSXPLEIPDRHKTAFV 618 + F D S V S D+ FW + R KTAF+ Sbjct: 312 TRRDSF---PLPLISEVFDSLSGAQVFTSCDMKVGFWQIQVSEESREKTAFI 360 >SB_58478| Best HMM Match : RVT_1 (HMM E-Value=1.3e-29) Length = 169 Score = 35.9 bits (79), Expect = 0.026 Identities = 14/39 (35%), Positives = 26/39 (66%) Frame = +3 Query: 393 APVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 +P+ + YK D+ + R+C+D R++NK V+ + P P I+ Sbjct: 2 SPIHVVYK--DNGELRVCVDLREVNKAVIRERFPIPRIQ 38 >SB_41639| Best HMM Match : Retrotrans_gag (HMM E-Value=6.6) Length = 324 Score = 35.1 bits (77), Expect = 0.046 Identities = 15/46 (32%), Positives = 27/46 (58%) Frame = +3 Query: 372 GSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 G S + +P+ + K + D R+CIDFR +NK ++ + P P ++ Sbjct: 212 GVGSRWVSPIVVVPKSDGD--LRMCIDFRKVNKAIIRERYPIPTMK 255 >SB_36217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1356 Score = 34.7 bits (76), Expect = 0.061 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 S S +A+P+ L KK RLC+D+R LN + P P IE Sbjct: 461 SKSDYASPIVLVRKKSG--AIRLCVDYRRLNSKTKRDAYPLPRIE 503 >SB_51862| Best HMM Match : ETS_PEA3_N (HMM E-Value=5.5) Length = 312 Score = 34.3 bits (75), Expect = 0.080 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +3 Query: 381 SPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 +P+ +P+ KK K RLC+D + LNK+V + P++E Sbjct: 240 TPWCSPMVPVMKKSG--KVRLCVDLKRLNKVVKREQFMLPMLE 280 >SB_41121| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 550 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +3 Query: 372 GSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 G S + +P+ + K + D R+CIDFR +N+ ++ + P P ++ Sbjct: 396 GVGSRWVSPIVVVPKSDGD--LRMCIDFRKVNEAIIRERYPIPTMQ 439 >SB_40311| Best HMM Match : Bet_v_I (HMM E-Value=4.9) Length = 128 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +3 Query: 372 GSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 G S + +P+ + K + D R+CIDFR +N+ ++ + P P ++ Sbjct: 75 GVGSRWVSPIVVVPKSDGD--LRMCIDFRKVNEAIIRERYPIPTMQ 118 >SB_36295| Best HMM Match : Bet_v_I (HMM E-Value=4.9) Length = 128 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +3 Query: 372 GSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 G S + +P+ + K + D R+CIDFR +N+ ++ + P P ++ Sbjct: 75 GVGSRWVSPIVVVPKSDGD--LRMCIDFRKVNEAIIRERYPIPTMQ 118 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +3 Query: 372 GSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 G S + +P+ + K + D R+CIDFR +N+ ++ + P P ++ Sbjct: 172 GVGSRWVSPIVVVPKSDGD--LRMCIDFRKVNEAIIRERYPIPTMQ 215 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +3 Query: 372 GSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 G S + +P+ + K + D R+CIDFR +N+ ++ + P P ++ Sbjct: 1484 GVGSRWVSPIVVVPKSDGD--LRMCIDFRKVNEAIIRERYPIPTMQ 1527 >SB_15517| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 799 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +3 Query: 372 GSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 G S + +P+ + K + D R+CIDFR +N+ ++ + P P ++ Sbjct: 471 GVGSRWVSPIVVVPKSDGD--LRMCIDFRKVNEAIIRERYPIPTMQ 514 >SB_59142| Best HMM Match : RVT_1 (HMM E-Value=2.5e-09) Length = 772 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 498 DGKLRICLDPKDLNKAIQRENYPLPTIE 525 >SB_44711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 714 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 574 DGKLRICLDPKDLNKAIQRENYPLPTIE 601 >SB_41742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1061 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 498 DGKLRICLDPKDLNKAIQRENYPLPTIE 525 >SB_34336| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 374 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 324 DGKLRICLDPKDLNKAIQRENYPLPTIE 351 >SB_32984| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 361 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 324 DGKLRICLDPKDLNKAIQRENYPLPTIE 351 >SB_26304| Best HMM Match : RVT_1 (HMM E-Value=2.3e-27) Length = 372 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 116 DGKLRICLDPKDLNKAIQRENYPLPTIE 143 >SB_26129| Best HMM Match : RVT_1 (HMM E-Value=1.2e-27) Length = 1036 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 498 DGKLRICLDPKDLNKAIQRENYPLPTIE 525 >SB_25074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 429 DGKLRICLDPKDLNKAIQRENYPLPTIE 456 >SB_21933| Best HMM Match : RVT_1 (HMM E-Value=9.1e-27) Length = 510 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 324 DGKLRICLDPKDLNKAIQRENYPLPTIE 351 >SB_15856| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) Length = 514 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 97 DGKLRICLDPKDLNKAIQRENYPLPTIE 124 >SB_2480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 8 DGKLRICLDPKDLNKAIQRENYPLPTIE 35 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 324 DGKLRICLDPKDLNKAIQRENYPLPTIE 351 >SB_45059| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 519 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 487 DGKLRICLDPKDLNKAIQRENYPLPTIE 514 >SB_40291| Best HMM Match : RVT_1 (HMM E-Value=6e-28) Length = 273 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 87 DGKLRICLDPKDLNKAIQRENYPLPTIE 114 >SB_31885| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) Length = 922 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 498 DGKLRICLDPKDLNKAIQRENYPLPTIE 525 >SB_28694| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) Length = 1045 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 459 DGKLRICLDPKDLNKAIQRENYPLPTIE 486 >SB_28242| Best HMM Match : RVT_1 (HMM E-Value=2.2e-27) Length = 381 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 116 DGKLRICLDPKDLNKAIQRENYPLPTIE 143 >SB_27583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 487 DGKLRICLDPKDLNKAIQRENYPLPTIE 514 >SB_25888| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 606 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 498 DGKLRICLDPKDLNKAIQRENYPLPTIE 525 >SB_22848| Best HMM Match : RVT_1 (HMM E-Value=5.1e-15) Length = 630 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 8 DGKLRICLDPKDLNKAIQRENYPLPTIE 35 >SB_16416| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 358 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 274 DGKLRICLDPKDLNKAIQRENYPLPTIE 301 >SB_16379| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 499 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 391 DGKLRICLDPKDLNKAIQRENYPLPTIE 418 >SB_14764| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 820 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 736 DGKLRICLDPKDLNKAIQRENYPLPTIE 763 >SB_11034| Best HMM Match : Securin (HMM E-Value=6.8) Length = 249 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 116 DGKLRICLDPKDLNKAIQRENYPLPTIE 143 >SB_10464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 324 DGKLRICLDPKDLNKAIQRENYPLPTIE 351 >SB_7494| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) Length = 960 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 399 DGKLRICLDPKDLNKAIQRENYPLPTIE 426 >SB_3197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 434 DGKLRICLDPKDLNKAIQRENYPLPTIE 461 >SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1246 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P IE Sbjct: 463 DGKLRICLDPKDLNKAIQRENYPLPTIE 490 >SB_18177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1050 Score = 33.1 bits (72), Expect = 0.19 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 5/64 (7%) Frame = +3 Query: 333 KSNIEATTEKF-DRGSYSPFAAPV----TLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPF 497 + ++A +K ++ +P AP ++ ++ K RLC+D +DLNK ++ + P Sbjct: 312 RDQLKAELDKMVEQEIIAPVTAPTPWVSSMVVVPKEHGKLRLCLDPKDLNKAIMREHYPV 371 Query: 498 PLIE 509 P IE Sbjct: 372 PTIE 375 >SB_154| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 1170 Score = 33.1 bits (72), Expect = 0.19 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +3 Query: 381 SPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 S +A+P+ L KK RLC+D+R LN + P P +E Sbjct: 743 SDYASPIVLVRKKSG--AIRLCVDYRKLNGKTQRDAYPLPRVE 783 >SB_20817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 32.7 bits (71), Expect = 0.25 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 426 DKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D K R+C+D +DLNK + ++ P P +E Sbjct: 234 DGKLRICLDPKDLNKAIQRENYPLPTLE 261 >SB_4881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 32.7 bits (71), Expect = 0.25 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 5/64 (7%) Frame = +3 Query: 333 KSNIEATTEKF-DRGSYSPFAAPV----TLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPF 497 + ++A +K ++ +P AP TL + + K RLC+D +DLNK + + P Sbjct: 356 RDQLKAELDKIVEQEIIAPVTAPTLWVSTLVVVPKKNGKLRLCLDPKDLNKATMREHYPL 415 Query: 498 PLIE 509 P I+ Sbjct: 416 PTIK 419 >SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1957 Score = 32.7 bits (71), Expect = 0.25 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +3 Query: 357 EKFDRGSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 E+ + + + +P+ + K D K R+C+D R N+ ++ + P P IE Sbjct: 1189 EEIPEATPTRWVSPLVVV-PKADGKDIRVCVDMRRANEAIIRERQPIPTIE 1238 >SB_16234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1150 Score = 32.3 bits (70), Expect = 0.32 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Frame = +3 Query: 366 DRGSYSP----FAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 DRG P +A+P+ L KK RLC+D+R LN ++ P P I+ Sbjct: 1017 DRGVIQPSQIDYASPIVLVRKKSGT--LRLCVDYRRLNAKSRREAYPLPRID 1066 >SB_35304| Best HMM Match : Kdo (HMM E-Value=1.1) Length = 185 Score = 32.3 bits (70), Expect = 0.32 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K RLCID +DLNK + P P IE Sbjct: 25 KLRLCIDHKDLNKALKRSHYPMPTIE 50 >SB_53136| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) Length = 934 Score = 31.9 bits (69), Expect = 0.43 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K R+C+D +DLNK + ++ P P IE Sbjct: 428 KLRICLDPKDLNKAIQRENYPLPTIE 453 >SB_13241| Best HMM Match : RTP801_C (HMM E-Value=4) Length = 325 Score = 31.9 bits (69), Expect = 0.43 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +3 Query: 381 SPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 SP+++ + KK D RLC DFR LN V P P ++ Sbjct: 279 SPYSSALVCVRKK--DGNLRLCTDFRALNSKTVSDRHPLPRVK 319 >SB_56418| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-35) Length = 1898 Score = 31.9 bits (69), Expect = 0.43 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +3 Query: 357 EKFDRGSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 E+ + + + +P+ + K D K R+C+D R N+ ++ + P P IE Sbjct: 1317 EELPEATPTRWVSPLVVV-PKGDGKDIRVCVDMRRSNEAIIRERHPIPTIE 1366 >SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 31.9 bits (69), Expect = 0.43 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 KT +C+D +DLNK + ++ P P IE Sbjct: 491 KTAICLDPKDLNKAIQRENYPLPTIE 516 >SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1925 Score = 31.5 bits (68), Expect = 0.57 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +3 Query: 381 SPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 +P+ +PV + K + RLC+D R N+ VV + P P ++ Sbjct: 753 TPWVSPVVIVPKPSGE--IRLCVDMRMANEAVVRKRHPIPTVD 793 >SB_2514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 31.5 bits (68), Expect = 0.57 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +3 Query: 372 GSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIET**PK 524 G P A +L Y+++ + + R+C+D +DLN + + P +E PK Sbjct: 95 GEGEPTAWVNSLVYRRKPNGRLRICLDPKDLNAAIQREQHVTPTLEEILPK 145 >SB_31097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 31.5 bits (68), Expect = 0.57 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +3 Query: 381 SPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 +P+ +PV + K + RLC+D R N+ VV + P P ++ Sbjct: 101 TPWVSPVVIVPKPSGE--IRLCVDMRMANEAVVRKRHPIPTVD 141 >SB_25619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1038 Score = 31.1 bits (67), Expect = 0.75 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +3 Query: 372 GSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 G S + +P+ + K D+ R+CID R +N+ V+ + P P ++ Sbjct: 486 GVASRWVSPIVVIPKAGDE--IRMCIDLRKVNQAVLRERYPIPTVQ 529 >SB_6770| Best HMM Match : Dehydrin (HMM E-Value=4.9) Length = 362 Score = 31.1 bits (67), Expect = 0.75 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K RLCID +DLNK + P P IE Sbjct: 332 KLRLCIDPKDLNKALKRSHYPMPTIE 357 >SB_47653| Best HMM Match : zf-CCHC (HMM E-Value=0.0017) Length = 759 Score = 31.1 bits (67), Expect = 0.75 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +3 Query: 366 DRGSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 + S + + + + + YK D+ R+C+D R++N+ V+ + P P I Sbjct: 11 EEASGASWESLIHVVYKDNDE--LRVCVDLREVNEAVIRERFPIPRI 55 >SB_23305| Best HMM Match : RVT_1 (HMM E-Value=0.0013) Length = 808 Score = 31.1 bits (67), Expect = 0.75 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +3 Query: 381 SPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFP 500 SP+++ + KK D RLC DFR LN V P P Sbjct: 126 SPYSSALVCVRKK--DGNLRLCTDFRALNSKTVSDRHPLP 163 >SB_17130| Best HMM Match : RVT_1 (HMM E-Value=0.0013) Length = 994 Score = 31.1 bits (67), Expect = 0.75 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +3 Query: 381 SPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFP 500 SP+++ + KK D RLC DFR LN V P P Sbjct: 683 SPYSSALVCVRKK--DGNLRLCTDFRALNSKTVSDRHPLP 720 >SB_10776| Best HMM Match : RVT_1 (HMM E-Value=2e-27) Length = 239 Score = 31.1 bits (67), Expect = 0.75 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K RLCID +DLNK + P P IE Sbjct: 25 KLRLCIDPKDLNKALKRSHYPMPTIE 50 >SB_1625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 31.1 bits (67), Expect = 0.75 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K RLCID +DLNK + P P IE Sbjct: 314 KLRLCIDPKDLNKALKRSHYPMPTIE 339 >SB_49941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 30.7 bits (66), Expect = 0.99 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +3 Query: 387 FAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 + +P+ +A K+ K RLCID + LNK + P P+I+ Sbjct: 75 WVSPMVVAVKRNG--KIRLCIDPKPLNKALKRNRYPLPVID 113 >SB_43987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 30.7 bits (66), Expect = 0.99 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 381 SPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 +P+ PV + K++ + RLCID R N + + P P + Sbjct: 526 APWVNPVVIVPKRQGE--IRLCIDMRQANNAITRRCYPIPTV 565 >SB_59677| Best HMM Match : RVT_1 (HMM E-Value=2.1e-28) Length = 1159 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 417 KEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 K+ + K RLCID + LNK + P P+I+ Sbjct: 352 KKPNGKIRLCIDSKPLNKALKRNRYPLPVID 382 >SB_51339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 406 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +3 Query: 372 GSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 G S + +P+ + K ++ R+CID R +N+ V+ + P P ++ Sbjct: 64 GVASRWVSPIVVTPKANEE--IRMCIDLRKVNQAVLRERHPIPTMQ 107 >SB_28907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 726 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 417 KEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 K+ ++K RLCID + LNK P P+I+ Sbjct: 467 KKPNEKIRLCIDPKPLNKAFKRNRYPLPVID 497 >SB_7986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +3 Query: 381 SPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 +P+ + + + KK + K RL +D +DLNK+++ + P P I Sbjct: 109 TPWVSSLVVVPKK--NCKLRLSLDPKDLNKVIMREHYPLPTI 148 >SB_52232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 405 LAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 L ++ DK RLC+D DLN+ +V + P IE Sbjct: 399 LVIVEKKDKSLRLCLDPPDLNEAIVREDYKPPSIE 433 >SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3293 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 417 KEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 K+ + K RLCID + LNK + P P+I+ Sbjct: 2583 KKPNGKIRLCIDPKPLNKALKRNRYPLPVID 2613 >SB_45442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 405 LAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 L ++ DK RLC+D DLN+ +V + P IE Sbjct: 350 LVIVEKKDKSLRLCLDPPDLNEAIVREDYKPPSIE 384 >SB_40823| Best HMM Match : rve (HMM E-Value=1.4e-12) Length = 651 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 405 LAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 L ++ DK RLC+D DLN+ +V + P IE Sbjct: 226 LVIVEKKDKSLRLCLDPPDLNEAIVREDYKPPSIE 260 >SB_38927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 405 LAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 L ++ DK RLC+D DLN+ +V + P IE Sbjct: 29 LVIVEKKDKSLRLCLDPPDLNEAIVREDYKPPSIE 63 >SB_33701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 974 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 417 KEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 K+ + K RLCID + LNK + P P+I+ Sbjct: 164 KKPNGKIRLCIDPKPLNKALKRNRYPLPVID 194 >SB_24668| Best HMM Match : RVT_1 (HMM E-Value=0.4) Length = 523 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 417 KEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 K+ + K RLCID + LNK + P P+I+ Sbjct: 243 KKPNGKIRLCIDPKPLNKALKRNRYPLPVID 273 >SB_22716| Best HMM Match : zf-CCHC (HMM E-Value=0.0097) Length = 396 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 417 KEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 K+ + K RLCID + LNK + P P+I+ Sbjct: 324 KKPNGKIRLCIDPKPLNKALKRNRYPLPVID 354 >SB_4272| Best HMM Match : RVT_1 (HMM E-Value=2e-28) Length = 876 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K RLCID +D NK + P P IE Sbjct: 151 KLRLCIDPKDFNKALKRSHYPMPTIE 176 >SB_1247| Best HMM Match : RVT_1 (HMM E-Value=4.6e-29) Length = 572 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 417 KEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 K+ + K RLCID + LNK + P P+I+ Sbjct: 191 KKPNGKIRLCIDPKPLNKALKRNRHPLPVID 221 >SB_284| Best HMM Match : rve (HMM E-Value=0.001) Length = 1201 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 417 KEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 K+ + K RLCID + LNK + P P+I+ Sbjct: 500 KKPNGKIRLCIDPKPLNKALKRNRYPLPVID 530 >SB_54427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 856 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K RLCID +D NK + P P IE Sbjct: 101 KLRLCIDPKDFNKALKRSHYPMPTIE 126 >SB_53966| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) Length = 484 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K RLCID +D NK + P P IE Sbjct: 37 KLRLCIDPKDFNKALKRSHYPMPTIE 62 >SB_49245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 526 SKL*VLFSLDINSAFWSXPLEIPDRHKTAFV 618 SK V LD NS FW PL+ R T F+ Sbjct: 2 SKSRVFSKLDANSGFWQLPLDKESRLLTTFI 32 >SB_45583| Best HMM Match : RVT_1 (HMM E-Value=1.4e-05) Length = 182 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 405 LAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 L ++ DK RLC+D DLN+ +V + P IE Sbjct: 29 LVIVEKKDKSLRLCLDPPDLNEAIVREDYKPPSIE 63 >SB_45121| Best HMM Match : rve (HMM E-Value=3.8e-09) Length = 1111 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 417 KEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 K+ + K RLCID + LNK + P P+I+ Sbjct: 346 KKPNGKIRLCIDPKPLNKALKRNRYPLPVID 376 >SB_42130| Best HMM Match : rve (HMM E-Value=5.9e-13) Length = 975 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 405 LAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 L ++ DK RLC+D DLN+ +V + P IE Sbjct: 463 LVIVEKKDKSLRLCLDPPDLNEAIVREDYKPPSIE 497 >SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) Length = 1702 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 405 LAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 L ++ DK RLC+D DLN+ +V + P IE Sbjct: 1131 LVIVEKKDKSLRLCLDPPDLNEAIVREDYKPPSIE 1165 >SB_12250| Best HMM Match : zf-CCHC (HMM E-Value=0.0097) Length = 349 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 417 KEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 K+ + K RLCID + LNK + P P+I+ Sbjct: 277 KKPNGKIRLCIDPKPLNKALKRNRYPLPVID 307 >SB_8862| Best HMM Match : rve (HMM E-Value=3.3e-12) Length = 1358 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 405 LAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 L ++ DK RLC+D DLN+ +V + P IE Sbjct: 571 LVIVEKKDKSLRLCLDPPDLNEAIVREDYKPPSIE 605 >SB_4914| Best HMM Match : RVT_1 (HMM E-Value=2.5e-16) Length = 548 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 405 LAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 L ++ DK RLC+D DLN+ +V + P IE Sbjct: 61 LVIVEKKDKSLRLCLDPPDLNEAIVREDYKPPSIE 95 >SB_1416| Best HMM Match : RVT_1 (HMM E-Value=1.8e-37) Length = 857 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +3 Query: 387 FAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIET**PK 524 + AP+ A K ++K R+C+D R LNK V + P ++ PK Sbjct: 402 WCAPMIPAAK--GNEKVRICVDLRRLNKSVKQERYVLPTLDDVVPK 445 >SB_51031| Best HMM Match : RVT_1 (HMM E-Value=1.8e-37) Length = 858 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +3 Query: 387 FAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIET**PK 524 + AP+ A K ++K R+C+D R LNK V + P ++ PK Sbjct: 403 WCAPMIPAAK--GNEKVRICVDLRRLNKSVKQERYVLPTLDDVVPK 446 >SB_56918| Best HMM Match : zf-CCHC (HMM E-Value=7.4e-07) Length = 517 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 416 VFTKLDANSGFWQIPLDEESRLLTTFV 442 >SB_56534| Best HMM Match : RVT_1 (HMM E-Value=5.5e-28) Length = 1052 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 524 VFTKLDANSGFWQIPLDEESRLLTTFV 550 >SB_49535| Best HMM Match : RVT_1 (HMM E-Value=5.1e-32) Length = 991 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 396 VFTKLDANSGFWQIPLDEESRLLTTFV 422 >SB_41052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 535 VFTKLDANSGFWQIPLDEESRLLTTFV 561 >SB_21980| Best HMM Match : RVT_1 (HMM E-Value=1.5e-35) Length = 212 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 65 VFTKLDANSGFWQIPLDEESRLLTTFV 91 >SB_19811| Best HMM Match : RVT_1 (HMM E-Value=3.5e-32) Length = 670 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 370 VFTKLDANSGFWQIPLDEESRLLTTFV 396 >SB_4361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 16 VFTKLDANSGFWQIPLDEESRLLTTFV 42 >SB_3041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 939 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 151 VFTKLDANSGFWQIPLDEESRLLTTFV 177 >SB_46816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1165 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 552 VFTKLDANSGFWQIPLDEESRLLTTFV 578 >SB_30012| Best HMM Match : Retrotrans_gag (HMM E-Value=1.1) Length = 306 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 210 VFTKLDANSGFWQIPLDEESRLLTTFV 236 >SB_13455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1387 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 S S +A+P+ + K + R+C+D+R LN+ S P P I Sbjct: 806 SSSEWASPLVIVRKPSEG--LRICVDYRKLNEGTRVTSYPLPNI 847 >SB_8133| Best HMM Match : RVT_1 (HMM E-Value=1.7e-34) Length = 387 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 240 VFTKLDANSGFWQIPLDEESRLLTTFV 266 >SB_6987| Best HMM Match : RVT_1 (HMM E-Value=2.2e-21) Length = 521 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 46 VFTKLDANSGFWQIPLDEESRLLTTFV 72 >SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3038 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 2304 VFTKLDANSGFWQIPLDEESRLLTIFV 2330 >SB_49131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1163 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K R+C+D +DLN+ ++ ++ P IE Sbjct: 745 KLRVCLDPKDLNRAILRENYQMPTIE 770 >SB_33569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 147 II*IYISNQKLRS**INTNLFLLWTNMMLALCRIMKPYRL 266 ++ I + + K+RS INT + +N LCR+ +PY L Sbjct: 23 VVWIRLRSAKIRSLIINTEETFISSNHSTTLCRLNEPYLL 62 >SB_23070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +3 Query: 372 GSYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 G S + +P+ + K++ + R+CID R N+ V+ + P P ++ Sbjct: 704 GVASRWVSPIVVIPKEKVE--IRMCIDLRKFNQAVLRERYPIPTMQ 747 >SB_2104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1219 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K LCID +DLNK + P P IE Sbjct: 152 KLPLCIDPKDLNKALKRSHYPMPTIE 177 >SB_58972| Best HMM Match : RVT_1 (HMM E-Value=0.013) Length = 166 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 65 VFTKLDANSGFWQIPLDEESRLLTIFV 91 >SB_56248| Best HMM Match : RVT_1 (HMM E-Value=8.6e-20) Length = 1193 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K R+C+D RDLNK + + P IE Sbjct: 416 KLRICLDPRDLNKAIQREHYPLLTIE 441 >SB_55708| Best HMM Match : UPF0103 (HMM E-Value=0.87) Length = 334 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIET**PK 524 K R+C+D +LNK ++ P P I+ PK Sbjct: 72 KLRVCLDPSELNKAIIRNHYPTPTIDEVSPK 102 >SB_43351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 + LD NS FW PL+ R T FV Sbjct: 65 IFTKLDANSGFWQIPLDEESRLLTTFV 91 >SB_33095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 538 VLFSLDINSAFWSXPLEIPDRHKTAFV 618 V LD NS FW PL+ R T FV Sbjct: 72 VFTKLDANSGFWQIPLDEESRLLTIFV 98 >SB_19411| Best HMM Match : RVT_1 (HMM E-Value=1.1e-32) Length = 541 Score = 28.3 bits (60), Expect = 5.3 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = +3 Query: 366 DRGSYSPFAAPV----TLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D+G P P ++ + + K RLCID + LNK + P P+I+ Sbjct: 169 DKGILVPVEVPTDWVSSMVVAVKRNGKIRLCIDPKPLNKALKRNRYPLPVID 220 >SB_14926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1638 Score = 28.3 bits (60), Expect = 5.3 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = +3 Query: 366 DRGSYSPFAAPV----TLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 D+G P P ++ + + K RLCID + LNK + P P+I+ Sbjct: 551 DKGILVPVEVPTDWVSSMVVAVKRNGKIRLCIDPKPLNKALKRNRYPLPVID 602 >SB_11313| Best HMM Match : RVT_1 (HMM E-Value=2.1e-18) Length = 284 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +3 Query: 411 YKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIET**PK 524 Y+++ + + R+C+D +DLN + + P +E PK Sbjct: 107 YRRKPNARLRICLDPKDLNAAIQREQHVTPTLEEILPK 144 >SB_10860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1292 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 128 EFQMSVNHLDLYQQSKIEKLVDKYKSVFAMDKYDVG 235 E +S L L Q+++++ L++K FAM D+G Sbjct: 537 EVDLSDTPLSLAQKARVQSLINKMSHTFAMHDKDLG 572 >SB_51570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1950 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 417 KEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 K+ + K RLCID + NK + P P+I+ Sbjct: 1170 KKPNGKIRLCIDPKPFNKALKRNRYPLPVID 1200 >SB_51205| Best HMM Match : RVT_1 (HMM E-Value=1.7e-21) Length = 387 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +3 Query: 381 SPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 +P+ + V + K ++ RLC+D R N+ V+ + P P ++ Sbjct: 50 TPWVSQVVIVPKPS--REIRLCVDMRMANEAVLRERHPIPSVD 90 >SB_50857| Best HMM Match : RVT_1 (HMM E-Value=9.8e-33) Length = 829 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 550 LDINSAFWSXPLEIPDRHKTAFV 618 LD NS FW PL+ R T FV Sbjct: 228 LDANSGFWQIPLDEESRLLTTFV 250 >SB_45933| Best HMM Match : RVT_1 (HMM E-Value=3.2e-13) Length = 901 Score = 27.9 bits (59), Expect = 7.0 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K R+C+D +DLN+ ++ ++ P +E Sbjct: 86 KLRVCLDPKDLNRAILRENYQMPTVE 111 >SB_35539| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07) Length = 1105 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/31 (32%), Positives = 21/31 (67%) Frame = +3 Query: 384 PFAAPVTLAYKKEDDKKTRLCIDFRDLNKIV 476 P A +L Y+++ + + R+C+D +DLN+ + Sbjct: 366 PTAWDNSLVYRRKPNGRLRICLDPKDLNQAI 396 >SB_8847| Best HMM Match : RVT_1 (HMM E-Value=5.5) Length = 250 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K RLCID + LNK + P P+I+ Sbjct: 114 KIRLCIDPKPLNKALKRNRYPLPVID 139 >SB_31771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1963 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 550 LDINSAFWSXPLEIPDRHKTAFV 618 LD NS FW PL+ R T FV Sbjct: 1179 LDANSGFWQIPLDEESRLLTTFV 1201 >SB_25232| Best HMM Match : RVT_1 (HMM E-Value=4.5e-09) Length = 160 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIE 509 K RLCID + LNK + P P+I+ Sbjct: 10 KIRLCIDPKPLNKALKRNRYPLPVID 35 >SB_21960| Best HMM Match : rve (HMM E-Value=4e-23) Length = 1109 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIET**PK 524 K R+C+D +LNK ++ P P ++ PK Sbjct: 311 KLRVCLDPSELNKAIIRNHYPTPTVDEVSPK 341 >SB_7045| Best HMM Match : rve (HMM E-Value=3.8e-22) Length = 1213 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 432 KTRLCIDFRDLNKIVVPQSXPFPLIET**PK 524 K R+C+D +LNK ++ P P ++ PK Sbjct: 411 KLRVCLDPSELNKAIIRNHYPTPTVDEVSPK 441 >SB_28930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 727 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +3 Query: 381 SPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 +P+ +PV + + + R+C+D R + VV + P P ++ Sbjct: 146 TPWVSPVVIVPRPSGE--IRICVDMRMAKEAVVRERHPIPTVD 186 >SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) Length = 2376 Score = 27.5 bits (58), Expect = 9.2 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLIE 509 S S +++P+ KK D RLC +R+L K P P ++ Sbjct: 1251 SSSSYSSPIVCIRKK--DGTLRLCCHYRELYKKCAADRHPIPRVQ 1293 >SB_31348| Best HMM Match : ERM (HMM E-Value=0) Length = 665 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +2 Query: 488 TTFPTYRDLMTKTVNCKYYSH*T*TQHF 571 +++ Y+ M + +NCK+YS T HF Sbjct: 398 SSYDDYKAPMVRGINCKHYSRDTCLMHF 425 >SB_28307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 761 Score = 27.5 bits (58), Expect = 9.2 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 5/64 (7%) Frame = +3 Query: 333 KSNIEATTEKF-DRGSYSPFAAPV----TLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPF 497 K +EA ++ D G P P L ++ RLC+D + LNK + + P Sbjct: 125 KPQLEAELQRLTDIGVIVPVDEPTDWMNNLVVATKESGDLRLCLDPKPLNKALKRERYPL 184 Query: 498 PLIE 509 P+I+ Sbjct: 185 PVID 188 >SB_24991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1146 Score = 27.5 bits (58), Expect = 9.2 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 5/64 (7%) Frame = +3 Query: 333 KSNIEATTEKF-DRGSYSPFAAPV----TLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPF 497 K +EA ++ D G P P L ++ RLC+D + LNK + + P Sbjct: 450 KPQLEAELQRLTDIGVIVPVDEPTDWVNNLVVATKESGDLRLCLDPKPLNKALKRERYPL 509 Query: 498 PLIE 509 P+I+ Sbjct: 510 PVID 513 >SB_20138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 860 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 S S +A+P+ + K R+C+D+R LN+ S P P I Sbjct: 158 SSSEWASPLVIVRKPSGG--LRICVDYRKLNEGTRVTSYPLPNI 199 >SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) Length = 1069 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 375 SYSPFAAPVTLAYKKEDDKKTRLCIDFRDLNKIVVPQSXPFPLI 506 S S +A+P+ + K R+C+D+R LN+ S P P I Sbjct: 570 SSSEWASPLVIVRKPSGG--LRICVDYRKLNEGTRVTSYPLPNI 611 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,235,691 Number of Sequences: 59808 Number of extensions: 271797 Number of successful extensions: 989 Number of sequences better than 10.0: 155 Number of HSP's better than 10.0 without gapping: 872 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 976 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -