BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0518 (618 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 21 7.3 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 7.3 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 9.6 AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. 21 9.6 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 128 EFQMSVNHLDLYQQSKIEKLVDKYKSV 208 + Q ++ HL Q +KL +K KS+ Sbjct: 76 DVQKALRHLPRSMQDSTKKLFNKCKSI 102 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = -2 Query: 599 LSGISNGIDQNAEFMSNENNTYSLLFWSLS 510 +S +SN N +N+NN L+++++ Sbjct: 82 ISSLSNNYISNISNYNNDNNYNKKLYYNIN 111 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = -1 Query: 342 YLTFNFCSVFNCACVRTLIAVF 277 YL NF +FN + L ++ Sbjct: 294 YLVINFSGIFNLVKISPLFTIW 315 >AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. Length = 76 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = -1 Query: 342 YLTFNFCSVFNCACVRTLIAVF 277 YL NF +FN + L ++ Sbjct: 44 YLVINFSGIFNLVKISPLFTIW 65 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,546 Number of Sequences: 438 Number of extensions: 2384 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -