BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0513 (611 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0603 - 7931162-7931446,7932217-7932718,7932824-7934925 31 0.72 11_01_0789 + 6612624-6612863 28 6.7 03_05_0665 + 26554362-26554796 28 6.7 >04_01_0603 - 7931162-7931446,7932217-7932718,7932824-7934925 Length = 962 Score = 31.1 bits (67), Expect = 0.72 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = -3 Query: 591 LESVHIVKIYSCTHVLEIIEXQNYIQKSWCIKIYRHFRSSYK 466 +E +HIV +Y+ V E IE ++K W + +++ F + ++ Sbjct: 817 IEGLHIVSLYNVKKVPEGIEFLRSLKKLWLLHLHKDFNTYWE 858 >11_01_0789 + 6612624-6612863 Length = 79 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/43 (25%), Positives = 25/43 (58%) Frame = -3 Query: 591 LESVHIVKIYSCTHVLEIIEXQNYIQKSWCIKIYRHFRSSYKD 463 +E ++IV + V + IE ++K W + ++++F+S + D Sbjct: 22 IEGLYIVSLPELERVPQGIETLCSLKKLWLLNLHKYFKSHWTD 64 >03_05_0665 + 26554362-26554796 Length = 144 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 219 NL*FISSIHKILTLKYYFNPLVSCKHSIHH 130 +L ISS+H TL PLV +H+ HH Sbjct: 49 HLPLISSLHTAPTLTTIATPLVGAQHTRHH 78 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,508,334 Number of Sequences: 37544 Number of extensions: 267559 Number of successful extensions: 349 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 349 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -