BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0509 (506 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IBI0 Cluster: Putative uncharacterized protein PF07_0... 35 1.2 UniRef50_P00476 Cluster: Modification methylase SPRI; n=1; Bacil... 33 3.7 >UniRef50_Q8IBI0 Cluster: Putative uncharacterized protein PF07_0114; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PF07_0114 - Plasmodium falciparum (isolate 3D7) Length = 956 Score = 34.7 bits (76), Expect = 1.2 Identities = 12/35 (34%), Positives = 24/35 (68%) Frame = -1 Query: 110 ILHHHNNMYSDHHKSRYIVSVQYSNIFSFALDKIS 6 I HH++N+ S+H+ + Y+ YS+ ++F L ++S Sbjct: 182 INHHNSNLISNHNSNIYMCKHNYSSYYNFTLQRVS 216 >UniRef50_P00476 Cluster: Modification methylase SPRI; n=1; Bacillus phage SPR|Rep: Modification methylase SPRI - Bacteriophage SPR Length = 439 Score = 33.1 bits (72), Expect = 3.7 Identities = 18/40 (45%), Positives = 25/40 (62%) Frame = -2 Query: 361 KWFNTLQYRN*LYKVGIKENIAMNELIGWSNLFKKKTPLE 242 K+FN Q R LY +GI+E++ NE WS FK+K L+ Sbjct: 152 KFFNVPQNRERLYIIGIREDLIKNE--EWSLDFKRKDILQ 189 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 395,434,258 Number of Sequences: 1657284 Number of extensions: 6865505 Number of successful extensions: 14914 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14843 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 30528237263 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -