SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0509
         (506 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   2.7  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   6.3  
AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory recept...    21   6.3  
AM292357-1|CAL23169.2|  355|Tribolium castaneum gustatory recept...    21   8.4  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.2 bits (45), Expect = 2.7
 Identities = 7/15 (46%), Positives = 10/15 (66%)
 Frame = +2

Query: 89   YYYDGAIFVILNSNF 133
            YYY G ++   N+NF
Sbjct: 2530 YYYPGDVYDYFNANF 2544


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +2

Query: 452  MFLFYLIKFY 481
            ++ FYL+KFY
Sbjct: 1027 IYFFYLVKFY 1036


>AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory receptor
           candidate 1 protein.
          Length = 373

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +2

Query: 452 MFLFYLIKFY 481
           ++ FYL+KFY
Sbjct: 308 IYFFYLVKFY 317


>AM292357-1|CAL23169.2|  355|Tribolium castaneum gustatory receptor
           candidate 36 protein.
          Length = 355

 Score = 20.6 bits (41), Expect = 8.4
 Identities = 9/35 (25%), Positives = 19/35 (54%)
 Frame = -2

Query: 376 VEKSLKWFNTLQYRN*LYKVGIKENIAMNELIGWS 272
           ++K LK   + +Y   LY++       +N++ GW+
Sbjct: 193 LQKYLKIETSCRYVGTLYRILTTMMEMVNDIFGWT 227


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,568
Number of Sequences: 336
Number of extensions: 2093
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12049355
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -