BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0508 (618 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23H3.14 |||LAlv9 family protein|Schizosaccharomyces pombe|ch... 28 1.2 SPAC7D4.03c |||conserved fungal family|Schizosaccharomyces pombe... 26 5.0 >SPAC23H3.14 |||LAlv9 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 469 Score = 27.9 bits (59), Expect = 1.2 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = -3 Query: 298 FELYFFFS*ITILYYTQHKCQNPSHYNKIHTQKSSNHVQIIASFFIINMIMIPTHR 131 FELY F T+ YY K Q+ S ++ H S++ + F++ + T R Sbjct: 356 FELYIFGMLATVKYYNFLKKQDDSILSQYHYLPSTSCISDYGETFLLEWMKTNTFR 411 >SPAC7D4.03c |||conserved fungal family|Schizosaccharomyces pombe|chr 1|||Manual Length = 886 Score = 25.8 bits (54), Expect = 5.0 Identities = 13/53 (24%), Positives = 24/53 (45%) Frame = -3 Query: 244 KCQNPSHYNKIHTQKSSNHVQIIASFFIINMIMIPTHRFSKPSLPQLLKTRIN 86 KC + Q+ S+ V +I F + ++ + T S+P L +L + N Sbjct: 151 KCPLSEQFINFINQQDSDKVVLIRGFLLPHLASLTTKNVSEPELDKLRHSLYN 203 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,393,137 Number of Sequences: 5004 Number of extensions: 46745 Number of successful extensions: 116 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -