BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0506 (620 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) 33 0.14 SB_41190| Best HMM Match : Extensin_2 (HMM E-Value=0.0029) 29 2.3 SB_3400| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 >SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) Length = 634 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 123 RGEGRPKKKWMDCVKDDMCKRGVSEEMVYDREVWKKK 13 R GRP+K W + +++D+ G++ DR WK K Sbjct: 585 RTRGRPRKNWHEVLREDLKLAGLTPHDTQDRVRWKLK 621 >SB_41190| Best HMM Match : Extensin_2 (HMM E-Value=0.0029) Length = 476 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 19 LPHFSIIYHFFAHSPLTHIVFHAI 90 +PHF YH S +TH VF A+ Sbjct: 428 IPHFMYTYHGVPSSDITHFVFRAL 451 >SB_3400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 356 RMF*SIHRERFLETSVCYWQLITLSISLYSIFEDRFFWVR 237 R F +HRE+ CYW TL + +FED +W R Sbjct: 118 RCFVKVHREKADPGKGCYW---TLDPAYEEMFEDGKYWRR 154 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,191,649 Number of Sequences: 59808 Number of extensions: 315857 Number of successful extensions: 689 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -