BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0501 (551 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ298450-1|ABC55264.1| 438|Homo sapiens type I cytokine recepto... 29 8.2 BC023567-1|AAH23567.2| 442|Homo sapiens cytokine receptor-like ... 29 8.2 AK057734-1|BAB71554.1| 433|Homo sapiens protein ( Homo sapiens ... 29 8.2 AF120151-1|AAD31758.1| 438|Homo sapiens cytokine receptor-like ... 29 8.2 AF046059-1|AAD02422.1| 442|Homo sapiens cytokine receptor relat... 29 8.2 >DQ298450-1|ABC55264.1| 438|Homo sapiens type I cytokine receptor like factor protein. Length = 438 Score = 29.5 bits (63), Expect = 8.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 310 YFGCDFFFTVWKTLV 354 YFGC FF+ WK LV Sbjct: 423 YFGCSFFYPGWKVLV 437 >BC023567-1|AAH23567.2| 442|Homo sapiens cytokine receptor-like factor 3 protein. Length = 442 Score = 29.5 bits (63), Expect = 8.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 310 YFGCDFFFTVWKTLV 354 YFGC FF+ WK LV Sbjct: 427 YFGCSFFYPGWKVLV 441 >AK057734-1|BAB71554.1| 433|Homo sapiens protein ( Homo sapiens cDNA FLJ25005 fis, clone CBL00905. ). Length = 433 Score = 29.5 bits (63), Expect = 8.2 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 5/80 (6%) Frame = -2 Query: 313 NKPGKHLYFAYVI----PQPVECIKHLIIHRQHLSTVLS*LA*VRRSFKHDTRGSAMSFE 146 N PG L FA+ P+ C ++HR LS LS L VRR F+ D + E Sbjct: 122 NCPGHCLMFAHRPRSWREMPIRCADFGVLHRNELSGTLSGLTGVRR-FQQDDAHIFCTVE 180 Query: 145 Q-HYSLKSSMNNIQCSLSSY 89 Q +K + +Q S++ Sbjct: 181 QIEEEIKGCLQFLQSVYSTF 200 >AF120151-1|AAD31758.1| 438|Homo sapiens cytokine receptor-like molecule 9 protein. Length = 438 Score = 29.5 bits (63), Expect = 8.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 310 YFGCDFFFTVWKTLV 354 YFGC FF+ WK LV Sbjct: 423 YFGCSFFYPGWKVLV 437 >AF046059-1|AAD02422.1| 442|Homo sapiens cytokine receptor related protein 4 protein. Length = 442 Score = 29.5 bits (63), Expect = 8.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 310 YFGCDFFFTVWKTLV 354 YFGC FF+ WK LV Sbjct: 427 YFGCSFFYPGWKVLV 441 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,557,486 Number of Sequences: 237096 Number of extensions: 1127836 Number of successful extensions: 1499 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1499 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5477474182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -