BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0499 (614 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 23 2.7 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 23 2.7 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 23 2.7 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 23 2.7 AF260821-1|AAG02019.1| 134|Tribolium castaneum alpha-esterase l... 22 4.7 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 6.2 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 506 PIGHVAMQKPPAFLTWSG 453 PIGH+ + P A W+G Sbjct: 36 PIGHLRFKAPQAPQPWTG 53 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 506 PIGHVAMQKPPAFLTWSG 453 PIGH+ + P A W+G Sbjct: 38 PIGHLRFKAPQAPQPWTG 55 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 506 PIGHVAMQKPPAFLTWSG 453 PIGH+ + P A W+G Sbjct: 36 PIGHLRFKAPQAPQPWTG 53 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 506 PIGHVAMQKPPAFLTWSG 453 PIGH+ + P A W+G Sbjct: 38 PIGHLRFKAPQAPQPWTG 55 >AF260821-1|AAG02019.1| 134|Tribolium castaneum alpha-esterase like protein E2 protein. Length = 134 Score = 21.8 bits (44), Expect = 4.7 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -1 Query: 506 PIGHVAMQKPPAFLTWSG 453 P+GH+ + P A W+G Sbjct: 10 PLGHLRFKAPQAPQPWTG 27 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = -3 Query: 600 YCKLAHSIYVRSLV*SHPCNXLSTGSSGHFESNRACS 490 Y L +YV L+ HP TG ++N+ C+ Sbjct: 287 YNTLFFIVYVSLLLGPHPTYFGKTGRKTVLKTNKYCN 323 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,226 Number of Sequences: 336 Number of extensions: 2750 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -