BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0498 (613 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g67280.1 68418.m08483 leucine-rich repeat transmembrane prote... 28 4.2 At4g02480.1 68417.m00335 AAA-type ATPase family protein contains... 28 4.2 At1g08310.1 68414.m00917 esterase/lipase/thioesterase family pro... 28 5.6 At2g43950.3 68415.m05464 expressed protein 27 7.4 At2g43950.2 68415.m05465 expressed protein 27 7.4 At2g43950.1 68415.m05463 expressed protein 27 7.4 At5g01070.1 68418.m00010 zinc finger (C3HC4-type RING finger) fa... 27 9.8 At4g37060.1 68417.m05248 patatin, putative similar to patatin-li... 27 9.8 At4g13460.1 68417.m02102 SET domain-containing protein (SUVH9) i... 27 9.8 At1g24190.1 68414.m03051 paired amphipathic helix repeat-contain... 27 9.8 >At5g67280.1 68418.m08483 leucine-rich repeat transmembrane protein kinase, putative Length = 751 Score = 28.3 bits (60), Expect = 4.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 495 GAFLGADRALCIRDFYKNGNSANVARRK 578 G + G+D L I DF NG+ AN RK Sbjct: 513 GFYWGSDEKLVIYDFVPNGSLANARYRK 540 >At4g02480.1 68417.m00335 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family; similar to Spastin (Swiss-Prot:Q9UBP0) [Homo sapiens] and Spastin (Fragment) (Swiss-Prot:Q9QYY8) [Mus musculus]; similar to mitochondrial sorting protein 1 (MSP1) protein (TAT-binding homolog 4) (Swiss-Prot:P28737) [Saccharomyces cerevisiae] Length = 1265 Score = 28.3 bits (60), Expect = 4.2 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = -2 Query: 531 VCTTHGPLRETLHSNKIPKSQATD*HSPRAPRNSCVHAITKTNVNFLLRH 382 V H P+RE L K K+ A + P P SC + T +F H Sbjct: 1177 VTAAHFPIREILEKEKKEKTAAQAENRPTPPLYSCTDVRSLTMNDFKAAH 1226 >At1g08310.1 68414.m00917 esterase/lipase/thioesterase family protein contains Interpro entry IPR000379 Length = 315 Score = 27.9 bits (59), Expect = 5.6 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = +3 Query: 132 KKKTSSPLITSESL-----FRVKKCNQCLCFSFGMWYYQPAYFSGTTSS 263 K+KT P++T E L F + + +CF G W ++PA S +T S Sbjct: 202 KRKTGFPMLTKEKLRERNVFDTLRDDFMVCF--GQWDFEPADLSISTKS 248 >At2g43950.3 68415.m05464 expressed protein Length = 280 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 577 FLRATFAELPFL*KSRMHNARSAPRNAP*QQNSQEPGYRLTLS 449 F+++T P L +HN ++ + N EPGY L LS Sbjct: 119 FIKSTLDVHPRLQLRALHNVKAQQGEVAMEANLTEPGYSLELS 161 >At2g43950.2 68415.m05465 expressed protein Length = 333 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 577 FLRATFAELPFL*KSRMHNARSAPRNAP*QQNSQEPGYRLTLS 449 F+++T P L +HN ++ + N EPGY L LS Sbjct: 119 FIKSTLDVHPRLQLRALHNVKAQQGEVAMEANLTEPGYSLELS 161 >At2g43950.1 68415.m05463 expressed protein Length = 343 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 577 FLRATFAELPFL*KSRMHNARSAPRNAP*QQNSQEPGYRLTLS 449 F+++T P L +HN ++ + N EPGY L LS Sbjct: 119 FIKSTLDVHPRLQLRALHNVKAQQGEVAMEANLTEPGYSLELS 161 >At5g01070.1 68418.m00010 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 124 Score = 27.1 bits (57), Expect = 9.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 228 YQPAYFSGTTSSTKDFDFNLQGFHHTLCDVYEL 326 Y+P+ SG SS+ D+D++ + C +E+ Sbjct: 20 YRPSDVSGEDSSSCDYDYDFHSAVRSFCGEFEI 52 >At4g37060.1 68417.m05248 patatin, putative similar to patatin-like latex allergen [Hevea brasiliensis][PMID:10589016]; contains patatin domain PF01734 Length = 414 Score = 27.1 bits (57), Expect = 9.8 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = +3 Query: 141 TSSPLITSESLFRVKKCNQCLCFSFGMWYYQPAYFSGTTSSTKDFDFNL 287 +S +T SL VK + C+ S Y+ P YFS S K FNL Sbjct: 166 SSYQALTDPSL-DVKVSDICIGTSAAPTYFPPYYFSNEDSQGKTRHFNL 213 >At4g13460.1 68417.m02102 SET domain-containing protein (SUVH9) identical to SUVH9 [Arabidopsis thaliana] GI:13517759; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain; identical to cDNA SUVH9 (SUVH9) GI:13517758 Length = 650 Score = 27.1 bits (57), Expect = 9.8 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = -3 Query: 605 VTNMSNAAEFSTRYIRRITVFIKVAYAQRTVRSEKRSIATKFPRARLPIDTLPAP 441 V++ + A +FS+ Y + + A+AQR R + ++ A +P++ P P Sbjct: 49 VSDFNEATDFSSDY-NTVAESARSAFAQRLQRHDDVAVLDSLTGAIVPVEENPEP 102 >At1g24190.1 68414.m03051 paired amphipathic helix repeat-containing protein similar to transcription co-repressor Sin3 [Xenopus laevis] GI:4960210; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 1353 Score = 27.1 bits (57), Expect = 9.8 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +3 Query: 117 KLSFAKKKTSSPLITSESLFRVKKCNQCLCFSFGMWYYQ 233 K++ K S L T + L RVKK + LC + W Q Sbjct: 1304 KIACGSSKVSYVLETEDLLVRVKKRRKTLCHNQDSWVRQ 1342 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,438,152 Number of Sequences: 28952 Number of extensions: 254031 Number of successful extensions: 622 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -