BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0497 (590 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 25 0.36 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 3.4 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 22 4.5 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 7.8 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 7.8 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 25.4 bits (53), Expect = 0.36 Identities = 12/44 (27%), Positives = 28/44 (63%) Frame = -3 Query: 315 YISINIFL*NRILTYLLLIFMFMSSVETLASIIQ*RKFSWSTLS 184 YI+ + + ++I++++ IF+ MS+V + S + + WS+L+ Sbjct: 7 YINRSELITSKIVSFVNSIFLVMSAVTIILSSLIFNQEQWSSLN 50 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 3.4 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -1 Query: 158 DLHFFWSRIRKYNPPRYHRSSTS 90 D H W R +N P Y SS S Sbjct: 280 DFHGKWERETGHNAPLYSPSSDS 302 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.8 bits (44), Expect = 4.5 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -3 Query: 420 ILAYPLSSCIFYKFQVNRMHGSVVITEHP*KPLDLYISINIFL*N 286 I + + +F+ M+ + ITEH KP L+ N FL N Sbjct: 210 IFGWTILQTVFFTVPRVLMYFDIFITEHESKPNWLFFLAN-FLTN 253 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 271 STIDLHVYELCRNSSKY 221 S ++LH+Y+L N + Y Sbjct: 401 SIVNLHIYDLHHNPAIY 417 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 271 STIDLHVYELCRNSSKY 221 S ++LH+Y+L N + Y Sbjct: 401 SIVNLHIYDLHHNPAIY 417 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,694 Number of Sequences: 336 Number of extensions: 2934 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -