BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0497 (590 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY219181-1|AAO60072.1| 4243|Homo sapiens fibrocystin L protein. 31 3.0 AK128617-1|BAC87532.1| 1372|Homo sapiens protein ( Homo sapiens ... 29 9.3 >AY219181-1|AAO60072.1| 4243|Homo sapiens fibrocystin L protein. Length = 4243 Score = 31.1 bits (67), Expect = 3.0 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -2 Query: 532 YPFPSLGIKINIIISHPHKDSHHYRPRNWCRESNTHI 422 Y P + + II+H ++ YR NW ES HI Sbjct: 888 YNIPMMAVSFGQIITHETENEFVYRGNNWPGESKIHI 924 >AK128617-1|BAC87532.1| 1372|Homo sapiens protein ( Homo sapiens cDNA FLJ46776 fis, clone TRACH3026650, highly similar to Actin cross-linking family protein 7. ). Length = 1372 Score = 29.5 bits (63), Expect = 9.3 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 532 YPFPSLGIKINIIISHPHKDSHHYRPRNWCRESNTH 425 Y P + + II+H ++ YR NW ES H Sbjct: 888 YNIPMMAVSFGQIITHETENEFVYRGNNWPGESKIH 923 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,602,025 Number of Sequences: 237096 Number of extensions: 1669284 Number of successful extensions: 2492 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2492 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6211568660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -