BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0497 (590 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z36753-10|CAA85341.1| 708|Caenorhabditis elegans Hypothetical p... 27 7.5 Z35640-6|CAA84702.2| 1226|Caenorhabditis elegans Hypothetical pr... 27 10.0 Z35639-9|CAA84700.2| 1226|Caenorhabditis elegans Hypothetical pr... 27 10.0 >Z36753-10|CAA85341.1| 708|Caenorhabditis elegans Hypothetical protein T09A5.12 protein. Length = 708 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 454 GGGNDENLCGGEK 492 GGG+DE LCGGE+ Sbjct: 632 GGGDDEILCGGEE 644 >Z35640-6|CAA84702.2| 1226|Caenorhabditis elegans Hypothetical protein F43D9.1 protein. Length = 1226 Score = 27.1 bits (57), Expect = 10.0 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 421 NISLSIKFMYFLQVSSQSDAWFSSYNGASVKTTRFI 314 N + IK YFL S ++ Y KTT+F+ Sbjct: 690 NTGIDIKEEYFLPAGSSEKSFIEQYRDQFGKTTQFV 725 >Z35639-9|CAA84700.2| 1226|Caenorhabditis elegans Hypothetical protein F43D9.1 protein. Length = 1226 Score = 27.1 bits (57), Expect = 10.0 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 421 NISLSIKFMYFLQVSSQSDAWFSSYNGASVKTTRFI 314 N + IK YFL S ++ Y KTT+F+ Sbjct: 690 NTGIDIKEEYFLPAGSSEKSFIEQYRDQFGKTTQFV 725 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,784,192 Number of Sequences: 27780 Number of extensions: 256391 Number of successful extensions: 671 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 671 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1247656244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -