BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0496 (609 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1080 + 11241590-11241625,11241723-11242018,11242113-112422... 28 5.0 04_04_1212 - 31786063-31786195,31786275-31786398,31786486-317865... 28 6.7 >12_01_1080 + 11241590-11241625,11241723-11242018,11242113-11242269, 11242381-11242449,11242551-11243480,11243868-11243906, 11244414-11244478,11244663-11244768,11244850-11245050, 11247001-11247201,11247756-11247779,11249425-11249586, 11249676-11249915,11250267-11250479,11250618-11250968, 11251041-11251193,11251649-11251858,11252049-11252267, 11252365-11252482,11252879-11253828,11254023-11254220, 11254294-11254553,11255316-11255505,11255817-11256169, 11258278-11258386,11258466-11258615,11258748-11258844, 11259315-11259415 Length = 2065 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 368 LKICIWNSTKYFIILYLAITWDNNP 442 +K I +S+ YF IL LA+ W+N+P Sbjct: 1436 VKKSIKSSSTYFDILGLAVCWENSP 1460 >04_04_1212 - 31786063-31786195,31786275-31786398,31786486-31786597, 31786691-31786822,31786929-31787111,31787351-31787479, 31787618-31787788,31788142-31788244,31788628-31788737, 31789158-31789265,31789337-31789512,31790082-31790352, 31790524-31790738,31791042-31792574,31792665-31792728, 31793171-31793251 Length = 1214 Score = 27.9 bits (59), Expect = 6.7 Identities = 27/77 (35%), Positives = 34/77 (44%), Gaps = 6/77 (7%) Frame = -2 Query: 317 LLGDWWFCK-*FASIRFRYDEIFQTAD--YVNNVR---IVI*TIFIFKVLFETKFNMYGG 156 L GDWW CK +R D +F D Y NN ++ I + FE F + Sbjct: 374 LTGDWWCCKLHIPKQAYRLDFVFFNGDTIYENNNHNDFVLQIESEINEHSFE-DFLVEEK 432 Query: 155 DNELDLLQQEEAERCEQ 105 EL+ L EEAER Q Sbjct: 433 QRELERLAAEEAERKRQ 449 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,885,923 Number of Sequences: 37544 Number of extensions: 220465 Number of successful extensions: 401 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 401 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -