BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0495 (606 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7VQZ4 Cluster: Protease IV, a signal peptide peptidase... 32 9.2 >UniRef50_Q7VQZ4 Cluster: Protease IV, a signal peptide peptidase; n=2; Candidatus Blochmannia|Rep: Protease IV, a signal peptide peptidase - Blochmannia floridanus Length = 625 Score = 32.3 bits (70), Expect = 9.2 Identities = 21/52 (40%), Positives = 26/52 (50%) Frame = -1 Query: 351 IIISLTMYFNIQHNYPNIHESKLTPEIFPCPQ*FIKMTT*YRQMAVIILNIN 196 III +T Y NIQHN IH S L I T ++Q++ LNIN Sbjct: 35 IIIGITTYINIQHNKQIIHPSALVLNIKGIIVDKPTTCTKFQQISKHFLNIN 86 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,901,383 Number of Sequences: 1657284 Number of extensions: 8256911 Number of successful extensions: 13032 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 12720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13028 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 43147568152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -