BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0494 (563 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1212 - 31786063-31786195,31786275-31786398,31786486-317865... 28 5.9 >04_04_1212 - 31786063-31786195,31786275-31786398,31786486-31786597, 31786691-31786822,31786929-31787111,31787351-31787479, 31787618-31787788,31788142-31788244,31788628-31788737, 31789158-31789265,31789337-31789512,31790082-31790352, 31790524-31790738,31791042-31792574,31792665-31792728, 31793171-31793251 Length = 1214 Score = 27.9 bits (59), Expect = 5.9 Identities = 26/77 (33%), Positives = 31/77 (40%), Gaps = 6/77 (7%) Frame = -2 Query: 316 LLGDWWFCK-*FASIRXRYDEIFQTAD--YVNNVRXXXXXXXIFKV---LFETKFNMYGG 155 L GDWW CK R D +F D Y NN ++ FE F + Sbjct: 374 LTGDWWCCKLHIPKQAYRLDFVFFNGDTIYENNNHNDFVLQIESEINEHSFE-DFLVEEK 432 Query: 154 DNELDLLQQEEAERCEQ 104 EL+ L EEAER Q Sbjct: 433 QRELERLAAEEAERKRQ 449 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,486,686 Number of Sequences: 37544 Number of extensions: 179887 Number of successful extensions: 327 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1293275844 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -