BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0490 (556 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 3e-27 SB_228| Best HMM Match : SAM_1 (HMM E-Value=10) 33 0.16 SB_54739| Best HMM Match : Plasmid_killer (HMM E-Value=9.1) 29 3.4 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_45788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 >SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 118 bits (284), Expect = 3e-27 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = +1 Query: 256 IRQAISKALIAFYQKYVDEASKKEIKDILVQYDRSLLVADPRRCEPKKFGGPGARXRYQK 435 IRQAISK+L+A+YQKYVDE SKKEI+DILVQYDRSLLVADPRR E KKFGGPGAR RYQK Sbjct: 45 IRQAISKSLVAYYQKYVDEVSKKEIRDILVQYDRSLLVADPRRTEAKKFGGPGARSRYQK 104 Query: 436 SYR 444 SYR Sbjct: 105 SYR 107 Score = 52.0 bits (119), Expect(2) = 2e-07 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +2 Query: 155 KLQEPILLLGKEKFSMVXIRVTVKGGGHVAQVY 253 K++EPILLLGKE+F V IRV VKGGGH +++Y Sbjct: 11 KVEEPILLLGKERFEGVDIRVRVKGGGHTSRIY 43 Score = 20.6 bits (41), Expect(2) = 2e-07 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +2 Query: 29 QAVQVFGRK 55 Q+VQVFGRK Sbjct: 3 QSVQVFGRK 11 >SB_228| Best HMM Match : SAM_1 (HMM E-Value=10) Length = 119 Score = 33.1 bits (72), Expect = 0.16 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 280 LIAFYQKYVDEASKKEIKDILVQYDRSLLVADPRRCE 390 ++AF QKY+D +KE +Q+ + +LV+ R CE Sbjct: 53 VLAFRQKYLDNFGRKETSKRFLQFAQGVLVSLARECE 89 >SB_54739| Best HMM Match : Plasmid_killer (HMM E-Value=9.1) Length = 263 Score = 28.7 bits (61), Expect = 3.4 Identities = 18/62 (29%), Positives = 32/62 (51%) Frame = +2 Query: 83 KRGHGMLRVNGRPLDLVEPRLLQYKLQEPILLLGKEKFSMVXIRVTVKGGGHVAQVYVSD 262 ++G+G++RV GR + + Y+L+ PI+L K + + I + GH+ Q V Sbjct: 86 QKGNGLIRVGGR----IGKAQVDYELRHPIILPYKNHVTDLIIMDHHQSVGHMGQESVLS 141 Query: 263 KL 268 L Sbjct: 142 SL 143 >SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -1 Query: 199 REFFLAEQKDRFLKFVLQQSGLNQ--VQWAP 113 R F + KDR+LK L++ G Q QW P Sbjct: 12 RSFLFTQDKDRYLKAGLKKYGYGQWTAQWVP 42 >SB_45788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.5 bits (58), Expect = 7.8 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 91 SWNAACKRAPIGLG*AQTAAVQTSGTYPFARQGKILYG 204 SW A K+ P G G ++ +G Y R G+ YG Sbjct: 19 SWQNAEKKKPAGFGRGRSKRGYVNGNYEARRPGERSYG 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,738,121 Number of Sequences: 59808 Number of extensions: 326254 Number of successful extensions: 925 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 925 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1288581898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -