BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0489 (639 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19G12.11 |coq9||ubiquinone biosynthesis protein Coq9 |Schizo... 28 0.99 SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces p... 28 1.3 SPBC1709.08 |cft1||cleavage factor one Cft1 |Schizosaccharomyces... 27 1.7 SPAPB1A10.04c |cwp1||geranylgeranyltransferase I alpha subunit C... 25 9.2 >SPAC19G12.11 |coq9||ubiquinone biosynthesis protein Coq9 |Schizosaccharomyces pombe|chr 1|||Manual Length = 250 Score = 28.3 bits (60), Expect = 0.99 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 204 GRILSIFWAYLQGGRDSIERL 142 GR++ + W+ LQG RD ++ L Sbjct: 120 GRVVQLIWSRLQGNRDIVQHL 140 >SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1323 Score = 27.9 bits (59), Expect = 1.3 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +3 Query: 69 ADLTWSVHRMGNLPRDLVVFYPEQQGALWSPFLPGDMPKKWIISAHARA 215 AD W+VH + VV Q+ +W+ LP D ++++ H RA Sbjct: 279 ADTQWNVHAARD---QWVVSTSSQKTIVWNLALPNDRAIEFMLHGHTRA 324 >SPBC1709.08 |cft1||cleavage factor one Cft1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1441 Score = 27.5 bits (58), Expect = 1.7 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = -1 Query: 597 KSTVIFTFVPL*LLTHASD*LETWXPCKNNVLHG*ADIYMSVGPPTPVAGALMM 436 K TV+F+ V L L AS + T DIY SV PTP+ G+L++ Sbjct: 264 KDTVLFSLVTLDLEQRASAVITTIQSLPY-------DIYASVSIPTPLGGSLLL 310 >SPAPB1A10.04c |cwp1||geranylgeranyltransferase I alpha subunit Cwp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 294 Score = 25.0 bits (52), Expect = 9.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 90 GPTKLSRQLAVVCMNVPGHHKP 25 GP+KL +A + N+P HKP Sbjct: 232 GPSKLDNLIANLRKNLPALHKP 253 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,869,125 Number of Sequences: 5004 Number of extensions: 63619 Number of successful extensions: 117 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -