BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0489 (639 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0196 + 1520015-1520191,1520483-1520527,1521851-1521910,152... 31 0.58 01_07_0016 - 40476014-40476333,40476598-40476740,40476945-404790... 31 1.0 06_03_1488 + 30484904-30485134,30485239-30487159,30487255-304876... 28 5.4 12_01_0179 - 1319291-1319332,1319884-1320579,1322759-1323207,132... 27 9.5 04_04_0319 + 24355275-24355401,24355504-24355603,24356271-243566... 27 9.5 >06_01_0196 + 1520015-1520191,1520483-1520527,1521851-1521910, 1522246-1522358,1522432-1522642,1523087-1523133, 1523211-1523369,1523521-1523624,1524300-1524634 Length = 416 Score = 31.5 bits (68), Expect = 0.58 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 240 PCVSPPMSNVGLFECTPFSSVFCFSHPRACMLLVS 344 PC +PPM+++G TP C + C +LVS Sbjct: 173 PCAAPPMASIGA-GSTPLHYAACGGEVKCCQILVS 206 >01_07_0016 - 40476014-40476333,40476598-40476740,40476945-40479099, 40479205-40480047,40480176-40480269,40480356-40481207, 40481367-40481437,40481750-40481821,40481977-40482019 Length = 1530 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +3 Query: 54 KQPPTA----DLTWSVHRMGNLPRDLVVFYPEQQGALWSPFLPGDM 179 +QPP D+ + P DL +FY + QG + PFL D+ Sbjct: 479 QQPPVLYQNNDMDTKASGQASYPEDLTLFYLDPQGGMQGPFLGADI 524 >06_03_1488 + 30484904-30485134,30485239-30487159,30487255-30487691, 30487777-30487983 Length = 931 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = -3 Query: 313 EKQKTEENGVHSKRPTFDIGGDTHGLKKR--KQTGARAWADIIHFLGISPGRK 161 E TEE+ R FD+ + + +TG+ W ++ G+SPGRK Sbjct: 804 ETYNTEEDAA-DHRMLFDLANEALEITMMGSTKTGSSLWRWVVDSTGVSPGRK 855 >12_01_0179 - 1319291-1319332,1319884-1320579,1322759-1323207, 1323291-1324903,1324991-1325077,1326983-1327251 Length = 1051 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -3 Query: 193 IHFLGISPGRKGLHRAPCCSG*NTTRSRGRLPMRWTD 83 + FLG++ ++ LH++P + TTR+RG+ M D Sbjct: 817 LQFLGLTVKKQSLHKSPTTT---TTRTRGKSVMSHRD 850 >04_04_0319 + 24355275-24355401,24355504-24355603,24356271-24356618, 24356705-24356745,24356821-24356867,24358043-24358107, 24358186-24358308,24358397-24358534,24358658-24358899, 24358988-24359118,24359363-24359388,24359746-24359882, 24359964-24360376,24360514-24360550,24360643-24360667, 24360755-24360887,24361241-24361340,24362015-24362115, 24362998-24363084 Length = 806 Score = 27.5 bits (58), Expect = 9.5 Identities = 16/67 (23%), Positives = 27/67 (40%) Frame = +1 Query: 400 INTIISHPHKDSHH*RPRNWCRGSNTHINISLSMKYIIFTRXPSFKSIGCMGQ*L*RNKR 579 I+++ H D H R R + T + ++ + + C+GQ L KR Sbjct: 641 IDSMEEDTHMDEQHARDEGLLRSTRTRTVARYFHQLLVDQKCQQRNNSVCLGQALEGTKR 700 Query: 580 KNHCRFY 600 K RF+ Sbjct: 701 KTSARFF 707 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,954,029 Number of Sequences: 37544 Number of extensions: 465338 Number of successful extensions: 1085 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1085 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -