BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0489 (639 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23918| Best HMM Match : rve (HMM E-Value=0.013) 30 1.4 SB_6029| Best HMM Match : TOM20_plant (HMM E-Value=2.4) 30 1.4 SB_26262| Best HMM Match : PHD (HMM E-Value=4.1) 28 7.4 >SB_23918| Best HMM Match : rve (HMM E-Value=0.013) Length = 1785 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +2 Query: 224 FSLLQPVCVPTNVECXSLRMHTILFGLLLLASESMHAFSES 346 FS+L+ T VEC +LRMH G LLL +++ A S Sbjct: 1455 FSILREYVYRTVVECYALRMHARADGNLLLETDTPVAMYRS 1495 >SB_6029| Best HMM Match : TOM20_plant (HMM E-Value=2.4) Length = 358 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +2 Query: 224 FSLLQPVCVPTNVECXSLRMHTILFGLLLLASESMHAFSES 346 FS+L+ T VEC +LRMH G LLL +++ A S Sbjct: 200 FSILREYVYRTVVECYALRMHARADGNLLLETDTPVAMYRS 240 >SB_26262| Best HMM Match : PHD (HMM E-Value=4.1) Length = 367 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 114 HVEGCPCDGPTKLSRQLA 61 H GCPCDG LS LA Sbjct: 198 HHNGCPCDGNNGLSASLA 215 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,507,678 Number of Sequences: 59808 Number of extensions: 509130 Number of successful extensions: 1201 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1201 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -