BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0489 (639 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL049563-3|CAI43017.1| 973|Homo sapiens transient receptor pote... 31 4.6 AF054568-1|AAF00002.1| 973|Homo sapiens transient receptor pote... 31 4.6 AC005191-1|AAC24563.1| 567|Homo sapiens WUGSC:H_DJ269O05.1 prot... 31 4.6 AB209258-1|BAD92495.1| 725|Homo sapiens transient receptor pote... 31 4.6 >AL049563-3|CAI43017.1| 973|Homo sapiens transient receptor potential cation channel, subfamily C, member 5 protein. Length = 973 Score = 30.7 bits (66), Expect = 4.6 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = +3 Query: 150 LWSPFLPGDMPKKWIISAHARAPVCFLFFNPCVS---PPMSNVGLFECTPFSSVFC 308 LW PG K W++ + FLF ++ P SN+GLF PF C Sbjct: 314 LWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFIC 369 >AF054568-1|AAF00002.1| 973|Homo sapiens transient receptor potential calcium channel 5 protein. Length = 973 Score = 30.7 bits (66), Expect = 4.6 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = +3 Query: 150 LWSPFLPGDMPKKWIISAHARAPVCFLFFNPCVS---PPMSNVGLFECTPFSSVFC 308 LW PG K W++ + FLF ++ P SN+GLF PF C Sbjct: 314 LWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFIC 369 >AC005191-1|AAC24563.1| 567|Homo sapiens WUGSC:H_DJ269O05.1 protein. Length = 567 Score = 30.7 bits (66), Expect = 4.6 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = +3 Query: 150 LWSPFLPGDMPKKWIISAHARAPVCFLFFNPCVS---PPMSNVGLFECTPFSSVFC 308 LW PG K W++ + FLF ++ P SN+GLF PF C Sbjct: 314 LWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFIC 369 >AB209258-1|BAD92495.1| 725|Homo sapiens transient receptor potential cation channel, subfamily C, member 5 variant protein. Length = 725 Score = 30.7 bits (66), Expect = 4.6 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = +3 Query: 150 LWSPFLPGDMPKKWIISAHARAPVCFLFFNPCVS---PPMSNVGLFECTPFSSVFC 308 LW PG K W++ + FLF ++ P SN+GLF PF C Sbjct: 315 LWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFIC 370 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,548,108 Number of Sequences: 237096 Number of extensions: 2598216 Number of successful extensions: 9132 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9125 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7028963750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -