BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0489 (639 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-1946|AAF55136.1| 1332|Drosophila melanogaster CG6752-PA... 29 4.0 Y14367-1|CAA74737.1| 394|Drosophila melanogaster lipase 3 protein. 28 9.3 BT023257-1|AAY55673.1| 394|Drosophila melanogaster IP02721p pro... 28 9.3 BT023252-1|AAY55668.1| 394|Drosophila melanogaster IP02723p pro... 28 9.3 AE014297-1666|AAF54935.1| 394|Drosophila melanogaster CG8823-PA... 28 9.3 >AE014297-1946|AAF55136.1| 1332|Drosophila melanogaster CG6752-PA protein. Length = 1332 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = -1 Query: 249 THTG*RRENKQALVHGRILSIFWAYLQG 166 T+ +EN +++HG +LS+FW Y++G Sbjct: 347 TNLASEKENSYSVLHG-LLSLFWNYMEG 373 >Y14367-1|CAA74737.1| 394|Drosophila melanogaster lipase 3 protein. Length = 394 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 97 WATFHVIWWYFTLNNKALYGVPSSLE-ICPKNG 192 W T+ I+W F+ N +Y VP+ ++ + K G Sbjct: 122 WPTYWQIFWNFSWNEIGMYDVPAMIDYVLAKTG 154 >BT023257-1|AAY55673.1| 394|Drosophila melanogaster IP02721p protein. Length = 394 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 97 WATFHVIWWYFTLNNKALYGVPSSLE-ICPKNG 192 W T+ I+W F+ N +Y VP+ ++ + K G Sbjct: 122 WPTYWQIFWNFSWNEIGMYDVPAMIDYVLAKTG 154 >BT023252-1|AAY55668.1| 394|Drosophila melanogaster IP02723p protein. Length = 394 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 97 WATFHVIWWYFTLNNKALYGVPSSLE-ICPKNG 192 W T+ I+W F+ N +Y VP+ ++ + K G Sbjct: 122 WPTYWQIFWNFSWNEIGMYDVPAMIDYVLAKTG 154 >AE014297-1666|AAF54935.1| 394|Drosophila melanogaster CG8823-PA protein. Length = 394 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 97 WATFHVIWWYFTLNNKALYGVPSSLE-ICPKNG 192 W T+ I+W F+ N +Y VP+ ++ + K G Sbjct: 122 WPTYWQIFWNFSWNEIGMYDVPAMIDYVLAKTG 154 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,577,412 Number of Sequences: 53049 Number of extensions: 766039 Number of successful extensions: 1693 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1691 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2682985500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -