BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0488 (614 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 61 7e-12 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 25 0.59 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 25 0.59 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 25 0.59 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 5.5 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 5.5 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 5.5 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 5.5 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 7.2 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 7.2 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 7.2 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 7.2 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 7.2 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 7.2 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 7.2 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 7.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 7.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 7.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 7.2 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 7.2 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 7.2 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 7.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 7.2 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 9.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 9.6 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 9.6 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 61.3 bits (142), Expect = 7e-12 Identities = 25/61 (40%), Positives = 41/61 (67%) Frame = +3 Query: 6 DFTVSAMHGDMDQREREVIMRQFRTGSSRVLITTDLLARGIDVQQVSCVINYDLPSNREN 185 ++ +++HGD QR+RE + F++G +L+ T + ARG+D++ VS VINYDLP + Sbjct: 475 NYPTTSIHGDRLQRQREEALADFKSGRMSILVATAVAARGLDIKNVSHVINYDLPKGIDE 534 Query: 186 Y 188 Y Sbjct: 535 Y 535 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 25.0 bits (52), Expect = 0.59 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 299 SIVEMPSDVANLI*GAYIFPIYILCPAFYCDI 394 +I+ MP +VA L+ G +IF I++ CD+ Sbjct: 86 AILVMPFNVAYLLLGKWIFGIHLCKLWLTCDV 117 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 25.0 bits (52), Expect = 0.59 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 299 SIVEMPSDVANLI*GAYIFPIYILCPAFYCDI 394 +I+ MP +VA L+ G +IF I++ CD+ Sbjct: 86 AILVMPFNVAYLLLGKWIFGIHLCKLWLTCDV 117 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 25.0 bits (52), Expect = 0.59 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 299 SIVEMPSDVANLI*GAYIFPIYILCPAFYCDI 394 +I+ MP +VA L+ G +IF I++ CD+ Sbjct: 86 AILVMPFNVAYLLLGKWIFGIHLCKLWLTCDV 117 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -1 Query: 443 EVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 + S+ R++ S R Y+N + EY+ R R Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -1 Query: 443 EVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 + S+ R++ S R Y+N + EY+ R R Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -1 Query: 443 EVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 + S+ R++ S R Y+N + EY+ R R Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -1 Query: 443 EVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 + S+ R++ S R Y+N + EY+ R R Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 270 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 316 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -1 Query: 476 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 336 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 321 MWPTSSKAPTFFRFIFCVL 377 MW TS + P FF +L Sbjct: 407 MWSTSLRDPVFFSIYKTIL 425 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 321 MWPTSSKAPTFFRFIFCVL 377 MW TS + P FF +L Sbjct: 407 MWSTSLRDPVFFSIYKTIL 425 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 321 MWPTSSKAPTFFRFIFCVL 377 MW TS + P FF +L Sbjct: 33 MWSTSLRDPVFFSIYKTIL 51 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,151 Number of Sequences: 438 Number of extensions: 3653 Number of successful extensions: 27 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -