BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0487 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56E4.03 |||aromatic aminotransferase |Schizosaccharomyces po... 31 0.21 SPBC2F12.03c |||EST1 family protein|Schizosaccharomyces pombe|ch... 25 7.8 >SPAC56E4.03 |||aromatic aminotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 30.7 bits (66), Expect = 0.21 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +2 Query: 272 TYALLISYLYYLHIQYLPKKICLYI-TLTYISTWLENTRILLYRNISIKN*QECDNRLHC 448 +Y L +YL Y YLPK +C YI + + W E + ++ E ++++H Sbjct: 359 SYTLRRNYLLYAMDTYLPKSVCSYIPPVAGMFIWFEVDKSRYIHADKNESIPEIESKIHA 418 Query: 449 RA 454 A Sbjct: 419 EA 420 >SPBC2F12.03c |||EST1 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 284 LISYLYYLHIQYLPKKICLYITLTYI 361 L+S L +HIQYL I Y TL I Sbjct: 164 LLSSLVTMHIQYLNSTIQFYTTLIAI 189 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,940,131 Number of Sequences: 5004 Number of extensions: 63994 Number of successful extensions: 134 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -