BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0487 (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0241 - 6731004-6731078,6731200-6731409,6731503-6731632,673... 29 2.6 04_01_0267 + 3584117-3584922,3585331-3585361 28 8.0 >03_02_0241 - 6731004-6731078,6731200-6731409,6731503-6731632, 6731719-6731889,6731991-6732113,6732238-6732342, 6732483-6732490 Length = 273 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 Query: 10 ELVDPRVVDPPGCRNSARV 66 +LVDPR+ DPPG R RV Sbjct: 197 QLVDPRIEDPPGARALNRV 215 >04_01_0267 + 3584117-3584922,3585331-3585361 Length = 278 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -2 Query: 614 FMVLTLPDQINIFFHNYIPFMVWLRILLKVYITVIGSVVNLIRDF 480 F++L L NI ++ +WLR LL V + V+G+ L + F Sbjct: 83 FLLLHLGGPDNITAYSLEDSKLWLRHLLTVVVQVLGAAYVLYKQF 127 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,456,499 Number of Sequences: 37544 Number of extensions: 338780 Number of successful extensions: 619 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -