BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0487 (687 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 30 2.0 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 29 2.7 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 29 3.5 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_11996| Best HMM Match : FYVE (HMM E-Value=0.004) 29 3.5 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_30032| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) 29 4.7 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 29 4.7 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_22029| Best HMM Match : Copine (HMM E-Value=3.6e-24) 29 4.7 SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 28 6.2 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 28 6.2 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_18643| Best HMM Match : Ion_trans (HMM E-Value=0) 28 6.2 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 28 8.1 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_20397| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 28 8.1 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_13423| Best HMM Match : 7tm_1 (HMM E-Value=5.8e-26) 28 8.1 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 28 8.1 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.38 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 76 Y*LPLVPNSCSPGDPL 29 Y +P+V NSCSPGDPL Sbjct: 7 YLIPMVSNSCSPGDPL 22 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.5 bits (68), Expect = 0.66 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 1/15 (6%) Frame = -3 Query: 70 LPLVP-NSCSPGDPL 29 LPLVP NSCSPGDPL Sbjct: 25 LPLVPSNSCSPGDPL 39 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.1 bits (67), Expect = 0.87 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 PLV NSCSPGDPL Sbjct: 2 PLVSNSCSPGDPL 14 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.1 bits (67), Expect = 0.87 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 103 HVLSECQFEY*LPLVPNSCSPGDPL 29 H+ + PL+ NSCSPGDPL Sbjct: 11 HLTTNAATRVRFPLISNSCSPGDPL 35 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 28 VVDPPGCRNSARVAVNIQID 87 +VDPPGCRNS A++ ID Sbjct: 15 LVDPPGCRNSIHKALDAAID 34 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 +PL+ NSCSPGDPL Sbjct: 52 IPLLSNSCSPGDPL 65 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 28 VVDPPGCRNSARVAVNIQID 87 +VDPPGCRNS R + ++ Sbjct: 15 LVDPPGCRNSIRTVAQLLVE 34 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 28 VVDPPGCRNSARVAV 72 +VDPPGCRNS +V V Sbjct: 70 LVDPPGCRNSMKVCV 84 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +1 Query: 28 VVDPPGCRNSARVAVNIQI 84 +VDPPGCRNS R I I Sbjct: 15 LVDPPGCRNSIRSTTTITI 33 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 103 HVLSECQFEY*LPLVPNSCSPGDPL 29 H L EC + + + NSCSPGDPL Sbjct: 41 HTLMECDY---VNDISNSCSPGDPL 62 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 PL NSCSPGDPL Sbjct: 19 PLASNSCSPGDPL 31 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -3 Query: 112 FRAHVLSECQFEY*-LP-LVPNSCSPGDPL 29 F HV C+ Y P L+ NSCSPGDPL Sbjct: 52 FVNHVGRSCEVVYQHFPCLISNSCSPGDPL 81 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 P++ NSCSPGDPL Sbjct: 16 PVISNSCSPGDPL 28 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 PL NSCSPGDPL Sbjct: 6 PLASNSCSPGDPL 18 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 L L+ NSCSPGDPL Sbjct: 35 LDLISNSCSPGDPL 48 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 P++ NSCSPGDPL Sbjct: 54 PILSNSCSPGDPL 66 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 28 VVDPPGCRNSARVAVNIQIDIPTER 102 +VDPPGCRNS +V +++ D P+ + Sbjct: 15 LVDPPGCRNSIKVHKDVK-DKPSHQ 38 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 76 Y*LPLVPNSCSPGDPL 29 Y + L+ NSCSPGDPL Sbjct: 29 YRVSLISNSCSPGDPL 44 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 +P V NSCSPGDPL Sbjct: 56 IPPVSNSCSPGDPL 69 >SB_11996| Best HMM Match : FYVE (HMM E-Value=0.004) Length = 610 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -1 Query: 387 ILVFSSHVEMYVKVIYRQIFLGRYCMCK*YKYDINNA*VMVGSTRI 250 + + +S V + V + +I LGR+ M Y YDI V +G RI Sbjct: 511 VAIVASRVAIQVSESWFEIILGRFWMIIIYIYDIKGNSVDMGDVRI 556 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 P++ NSCSPGDPL Sbjct: 14 PVLSNSCSPGDPL 26 >SB_30032| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) Length = 819 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 329 KICLYITLTYISTWLENTRILLYRNIS 409 K+C I LTY+ TWL + ++ R++S Sbjct: 508 KVCCGIGLTYVMTWLPSGITIIARSLS 534 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 PL NSCSPGDPL Sbjct: 84 PLSSNSCSPGDPL 96 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 P+ NSCSPGDPL Sbjct: 15 PITSNSCSPGDPL 27 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 +P + NSCSPGDPL Sbjct: 34 IPALSNSCSPGDPL 47 >SB_22029| Best HMM Match : Copine (HMM E-Value=3.6e-24) Length = 726 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 329 KICLYITLTYISTWLENTRILLYRNIS 409 K+C I LTY+ TWL + ++ R++S Sbjct: 124 KVCCGIGLTYVMTWLPSGITIIARSLS 150 >SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -3 Query: 97 LSECQFEY*LPL-VPNSCSPGDPL 29 + CQF+ L + NSCSPGDPL Sbjct: 1 MDACQFKADLVIKTSNSCSPGDPL 24 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 P + NSCSPGDPL Sbjct: 43 PTISNSCSPGDPL 55 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 64 LVPNSCSPGDPL 29 LV NSCSPGDPL Sbjct: 24 LVSNSCSPGDPL 35 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 64 LVPNSCSPGDPL 29 LV NSCSPGDPL Sbjct: 17 LVSNSCSPGDPL 28 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 28 VVDPPGCRNSARVAVNIQIDIPTERAL 108 +VDPPGCRNS + I I +P A+ Sbjct: 32 LVDPPGCRNSIMDSGLITIFLPIALAI 58 >SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 P+ NSCSPGDPL Sbjct: 9 PVTSNSCSPGDPL 21 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 64 LVPNSCSPGDPL 29 LV NSCSPGDPL Sbjct: 9 LVSNSCSPGDPL 20 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 64 LVPNSCSPGDPL 29 LV NSCSPGDPL Sbjct: 5 LVSNSCSPGDPL 16 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 64 LVPNSCSPGDPL 29 LV NSCSPGDPL Sbjct: 2 LVSNSCSPGDPL 13 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 L +V NSCSPGDPL Sbjct: 17 LTVVSNSCSPGDPL 30 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 28 VVDPPGCRNSARVAVNIQI 84 +VDPPGCRNS V+ I Sbjct: 15 LVDPPGCRNSMNANVSYSI 33 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 64 LVPNSCSPGDPL 29 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 79 EY*LPLVPNSCSPGDPL 29 E+ + V NSCSPGDPL Sbjct: 4 EFRITAVSNSCSPGDPL 20 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 + L+ NSCSPGDPL Sbjct: 32 ISLISNSCSPGDPL 45 >SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 LP NSCSPGDPL Sbjct: 17 LPAPSNSCSPGDPL 30 >SB_18643| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 1885 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/42 (26%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -2 Query: 548 WLRILLKVYITVIGS-VVNLIRDFFLITFTHNRHDSEDDCHI 426 W+ I +YI +I ++N+ F ++TF + + DC + Sbjct: 1158 WVAIYYVIYIIIIAFFMINIFVGFVIVTFQNEGEEEFKDCEL 1199 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 64 LVPNSCSPGDPL 29 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 82 FEY*LPLVPNSCSPGDPL 29 ++Y + + NSCSPGDPL Sbjct: 14 WKYAIDIASNSCSPGDPL 31 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 28 VVDPPGCRNSARVAV 72 +VDPPGCRNS ++ V Sbjct: 15 LVDPPGCRNSMKMKV 29 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 + L+ NSCSPGDPL Sbjct: 29 ISLISNSCSPGDPL 42 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 79 EY*LPLVPNSCSPGDPL 29 +Y +V NSCSPGDPL Sbjct: 342 QYLHSIVSNSCSPGDPL 358 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 64 LVPNSCSPGDPL 29 L+ NSCSPGDPL Sbjct: 17 LISNSCSPGDPL 28 >SB_20397| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 259 GPDHYLCIINIVFVLFTHTIPTQENLSVYH 348 G HY +NIV ++ ++P L V+H Sbjct: 92 GRHHYKLALNIVLFIYPKSLPLNSRLCVFH 121 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 28 VVDPPGCRNSARVAVNI 78 +VDPPGCRNS +A+ + Sbjct: 15 LVDPPGCRNSMCLALTL 31 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 +P NSCSPGDPL Sbjct: 7 MPRASNSCSPGDPL 20 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 64 LVPNSCSPGDPL 29 L+ NSCSPGDPL Sbjct: 8 LISNSCSPGDPL 19 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 P NSCSPGDPL Sbjct: 1191 PFASNSCSPGDPL 1203 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/14 (78%), Positives = 13/14 (92%), Gaps = 1/14 (7%) Frame = -3 Query: 67 PLVP-NSCSPGDPL 29 P++P NSCSPGDPL Sbjct: 63 PILPSNSCSPGDPL 76 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 88 CQFEY*LPLVPNSCSPGDPL 29 CQ E L NSCSPGDPL Sbjct: 12 CQMEV---LASNSCSPGDPL 28 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 P V NSCSPGDPL Sbjct: 8 PGVSNSCSPGDPL 20 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 LP NSCSPGDPL Sbjct: 11 LPQKSNSCSPGDPL 24 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 64 LVPNSCSPGDPL 29 L+ NSCSPGDPL Sbjct: 40 LISNSCSPGDPL 51 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 76 Y*LPLVPNSCSPGDPL 29 Y + L NSCSPGDPL Sbjct: 7 YFIMLASNSCSPGDPL 22 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 64 LVPNSCSPGDPL 29 L+ NSCSPGDPL Sbjct: 21 LISNSCSPGDPL 32 >SB_13423| Best HMM Match : 7tm_1 (HMM E-Value=5.8e-26) Length = 375 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = -2 Query: 530 KVYITV-IGSVVNLIRD-FFLITFTHNRHDSEDDCHILVSFLW 408 KV I V I ++ ++ D FF + F H R + CHI++ +W Sbjct: 107 KVSIIVSISNLTSIATDRFFNVFFPHKRIITIKRCHIIIVLIW 149 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 64 LVPNSCSPGDPL 29 L+ NSCSPGDPL Sbjct: 16 LISNSCSPGDPL 27 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 70 LPLVPNSCSPGDPL 29 L L NSCSPGDPL Sbjct: 659 LQLASNSCSPGDPL 672 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 67 PLVPNSCSPGDPL 29 P + NSCSPGDPL Sbjct: 8 PEISNSCSPGDPL 20 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,221,813 Number of Sequences: 59808 Number of extensions: 437645 Number of successful extensions: 1706 Number of sequences better than 10.0: 71 Number of HSP's better than 10.0 without gapping: 1648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1705 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -