BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0487 (687 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 25 0.51 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 24 1.6 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 2.1 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 23 2.7 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 4.8 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 8.3 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 25.4 bits (53), Expect = 0.51 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +3 Query: 243 HFLSVWTRPLLMHY*YRICIIYTYNTYPRKS 335 H ++ W R + +H R+ ++ YNT ++S Sbjct: 335 HVMAPWVRRVFIHVLPRLLVMRRYNTPSKRS 365 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 411 MEIFLYNNILVFSSHVEMYVKVIY 340 ++ F YNN V+ + VE Y +IY Sbjct: 190 VQSFDYNNTWVYIADVEGYALIIY 213 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.4 bits (48), Expect = 2.1 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = -2 Query: 566 YIPFMVWLRILLKVYITVIGS-VVNLIRDFFLITFTHNRHDSEDDCHILVSFLWRYFCII 390 YI R L+ Y ++ + +V I L+ F + + D +D +L++F W+ C+I Sbjct: 347 YIISRYVFRSALEDYCNIVATHLVCGILGSILVPFFYVQED-DDVKLVLLNFGWQMICLI 405 Query: 389 I 387 + Sbjct: 406 V 406 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 23.0 bits (47), Expect = 2.7 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 145 NYVITY*VKLTNFDSGIMLK*RIKKEHVRXRTDISYPCGPDHYLCIIN 288 +YVI+ VK T+F M+K +K +H IS + Y+ I++ Sbjct: 425 SYVISGIVKCTDFVDKAMVKQYVKVKHSATLGYISRVLEKEPYVIILD 472 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 6/40 (15%) Frame = +2 Query: 314 QYLPKKICLYITLTYISTWLEN------TRILLYRNISIK 415 +YLP + + ITLTY+ ++ T I+++RN S++ Sbjct: 26 KYLPLTLIVPITLTYVVIFVTGFVGNIITCIVIWRNPSMQ 65 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 320 LPKKICLYITLTYISTWL 373 +P K CL +TL ++T L Sbjct: 701 VPSKFCLSVTLLTVATSL 718 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,829 Number of Sequences: 438 Number of extensions: 4559 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -