BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0485 (628 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_33603| Best HMM Match : PHD (HMM E-Value=0.00046) 29 2.3 SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_57402| Best HMM Match : DEAD (HMM E-Value=0.42) 27 9.4 SB_54543| Best HMM Match : ResIII (HMM E-Value=1.9) 27 9.4 SB_50794| Best HMM Match : Cys_knot (HMM E-Value=2.2) 27 9.4 SB_48939| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_43554| Best HMM Match : LIM (HMM E-Value=0.91) 27 9.4 SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_27946| Best HMM Match : DEAD (HMM E-Value=0.42) 27 9.4 SB_26062| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_21910| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_9872| Best HMM Match : ResIII (HMM E-Value=0.36) 27 9.4 SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) 27 9.4 SB_59747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_56794| Best HMM Match : ResIII (HMM E-Value=0.63) 27 9.4 SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_53226| Best HMM Match : ResIII (HMM E-Value=0.45) 27 9.4 SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) 27 9.4 SB_48295| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) 27 9.4 SB_42858| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) 27 9.4 SB_31820| Best HMM Match : CG-1 (HMM E-Value=2.4) 27 9.4 SB_27423| Best HMM Match : ResIII (HMM E-Value=0.56) 27 9.4 SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) 27 9.4 SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) 27 9.4 SB_13172| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) 27 9.4 SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) 27 9.4 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 31.5 bits (68), Expect = 0.58 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 199 GSCKLPVQASFSLVVSNDHRYSCEDCGNW-HARC 101 G K P A SN C++CG W HA+C Sbjct: 205 GPVKYPCSACTKPTKSNQRAICCDECGQWTHAKC 238 >SB_33603| Best HMM Match : PHD (HMM E-Value=0.00046) Length = 396 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 199 GSCKLPVQASFSLVVSNDHRYSCEDCGNW-HARC 101 G K P A SN C++CG+W HA+C Sbjct: 97 GPVKHPCGACGKPTKSNQKAICCDECGHWMHAKC 130 >SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 199 GSCKLPVQASFSLVVSNDHRYSCEDCGNW-HARC 101 G K P A SN C++CG+W HA+C Sbjct: 97 GPVKHPCGACGKPTKSNQKAICCDECGHWMHAKC 130 >SB_3753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 976 Score = 28.7 bits (61), Expect = 4.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+RY CEDCG ++ C Sbjct: 704 SDYRYLCEDCGKPYSTC 720 >SB_57402| Best HMM Match : DEAD (HMM E-Value=0.42) Length = 428 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 338 SDYRCLCEDCGNPYSTC 354 >SB_54543| Best HMM Match : ResIII (HMM E-Value=1.9) Length = 521 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 273 SDYRCLCEDCGNPYSTC 289 >SB_50794| Best HMM Match : Cys_knot (HMM E-Value=2.2) Length = 396 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 134 SDYRCLCEDCGNPYSTC 150 >SB_48939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 590 SDYRCLCEDCGNPYSTC 606 >SB_43554| Best HMM Match : LIM (HMM E-Value=0.91) Length = 334 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 15 SDYRCLCEDCGNPYSTC 31 >SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1213 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 895 SDYRCLCEDCGNPYSTC 911 >SB_27946| Best HMM Match : DEAD (HMM E-Value=0.42) Length = 751 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 433 SDYRCLCEDCGNPYSTC 449 >SB_26062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1535 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 Query: 163 VKKKPEQEVYTIPPELKPQLKQ 228 +K QE +TIPPELKP L Q Sbjct: 1310 IKPNVHQE-FTIPPELKPPLPQ 1330 >SB_21910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 15 SDYRCLCEDCGNPYSTC 31 >SB_9872| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 624 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 338 SDYRCLCEDCGNPYSTC 354 >SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 842 SDYRCLCEDCGNPYSTC 858 >SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) Length = 1104 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCG ++RC Sbjct: 927 SDYRCLCEDCGKPYSRC 943 >SB_59747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1064 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 931 SDYRCLCEDCGNPYSTC 947 >SB_56794| Best HMM Match : ResIII (HMM E-Value=0.63) Length = 532 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 226 SDYRCLCEDCGNPYSTC 242 >SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 723 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = -1 Query: 199 GSCKLPVQASFSLVVSNDHRYSCEDCGNW-HARC 101 G CK P V SN CE C W H +C Sbjct: 12 GPCKFPCGVCAKPVKSNQAGIECEQCLLWYHKKC 45 >SB_53226| Best HMM Match : ResIII (HMM E-Value=0.45) Length = 880 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 797 SDYRCLCEDCGNPYSTC 813 >SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) Length = 1390 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 1072 SDYRCLCEDCGNPYSTC 1088 >SB_48295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1269 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 951 SDYRRLCEDCGNPYSTC 967 >SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) Length = 1236 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 918 SDYRRLCEDCGNPYSTC 934 >SB_42858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 876 SDYRCLCEDCGNPYSTC 892 >SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 949 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 871 SDYRCLCEDCGNPYSTC 887 >SB_31820| Best HMM Match : CG-1 (HMM E-Value=2.4) Length = 992 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 784 SDYRCLCEDCGNPYSTC 800 >SB_27423| Best HMM Match : ResIII (HMM E-Value=0.56) Length = 562 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 436 SDYRCLCEDCGNPYSTC 452 >SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) Length = 1178 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 858 SDYRCLCEDCGNPYSTC 874 >SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1179 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 873 SDYRCLCEDCGNPYSTC 889 >SB_13172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 599 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCG ++RC Sbjct: 422 SDYRCLCEDCGKPYSRC 438 >SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) Length = 1346 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 1027 SDYRCLCEDCGNPYSTC 1043 >SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) Length = 1106 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 151 NDHRYSCEDCGNWHARC 101 +D+R CEDCGN ++ C Sbjct: 895 SDYRCLCEDCGNPYSTC 911 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,036,530 Number of Sequences: 59808 Number of extensions: 288633 Number of successful extensions: 930 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -