BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0485 (628 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 26 0.85 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 26 0.85 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 26.2 bits (55), Expect = 0.85 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -1 Query: 199 GSCKLPVQASFSLVVSNDHRYSCEDCGNW--HARCR 98 G CKLP + +++ + D +SC C N + RCR Sbjct: 42 GCCKLPPELIDAVLSNVDLHWSCIGCTNMLKNPRCR 77 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 26.2 bits (55), Expect = 0.85 Identities = 8/27 (29%), Positives = 18/27 (66%) Frame = +2 Query: 464 TFFIYYFYVISSLRNVLLLSIRTLMIV 544 TFFIYY+Y +S+ ++ ++ +++ Sbjct: 574 TFFIYYYYAVSTANRHMVQVLKQQLVL 600 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 541,429 Number of Sequences: 2352 Number of extensions: 8864 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -