BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0484 (641 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_04_0072 - 15721866-15723563 31 1.0 01_04_0070 - 15704794-15706491 31 1.0 03_02_0932 + 12495700-12495738,12495859-12496093,12496178-124964... 28 5.5 >01_04_0072 - 15721866-15723563 Length = 565 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +2 Query: 416 CYTSNWVIRIYCLSSSYIHCRYRY*YTSIFYSATII--IAVPTGIKIF 553 CYTSNW + + ++ + C + +I+Y+ + +A+ G+KIF Sbjct: 342 CYTSNWWLTVSLVTFLTVFCIFFAITDTIYYNGKVYYGVAMRGGLKIF 389 >01_04_0070 - 15704794-15706491 Length = 565 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +2 Query: 416 CYTSNWVIRIYCLSSSYIHCRYRY*YTSIFYSATII--IAVPTGIKIF 553 CYTSNW + + ++ + C + +I+Y+ + +A+ G+KIF Sbjct: 342 CYTSNWWLTVSLVTFLTVFCIFFAITDTIYYNGKVYYGVAMRGGLKIF 389 >03_02_0932 + 12495700-12495738,12495859-12496093,12496178-12496423, 12496519-12496572,12497329-12497589,12497750-12497802, 12497893-12498016,12498147-12498401,12498798-12499888, 12500001-12500007,12500316-12500445,12500617-12500731, 12500783-12500853,12501246-12501354,12501550-12501738, 12502519-12502644,12503048-12503563 Length = 1206 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 251 LTCWRRRPNFISTFILIFWTS*SLYFNFTRI 343 + CWRR P F+L F + +LYF+ + I Sbjct: 442 MLCWRRPPVLALCFLLFFGSVEALYFSASLI 472 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,015,035 Number of Sequences: 37544 Number of extensions: 174332 Number of successful extensions: 272 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 272 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -