BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0481 (634 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 2.8 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 2.8 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 3.7 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 6.5 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 21 8.6 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 207 NTTWSHCGHPQCV 245 NT WSHC QCV Sbjct: 146 NTVWSHC---QCV 155 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 207 NTTWSHCGHPQCV 245 NT WSHC QCV Sbjct: 146 NTVWSHC---QCV 155 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +2 Query: 359 AVGSGLGLPLALLKSMXXGNHSPSGGPYARLP 454 +VG G+P G P G PY R P Sbjct: 53 SVGLRQGIPPHHYGGPPSGGQPPQGMPYPRFP 84 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.4 bits (43), Expect = 6.5 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = +1 Query: 244 FPEVFLPRTIRLWNELPSTVFPERYDMFFFKRGLWRVLSGRQRFGSAPGTAEVHG 408 F ++ + T++LW PS+V + + + G W + G FG P +HG Sbjct: 429 FEKLDVKVTVQLWLGDPSSVLSHGHRVIYSTVGHWYLDCG---FG--PWKPSMHG 478 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -3 Query: 392 VPGADPNRCLPLNTLHKPRLKK 327 +P A N C N HK ++K Sbjct: 62 IPDALKNECAKCNDKHKEGIRK 83 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,938 Number of Sequences: 336 Number of extensions: 3022 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -