BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0478 (701 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Ma... 27 3.4 SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyce... 26 4.5 SPAC3A11.05c |kms1||meiotic spindle pole body protein Kms1|Schiz... 26 6.0 >SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Manual Length = 918 Score = 26.6 bits (56), Expect = 3.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 357 INKIRRSYLLRYFSVFIYAQNMILYS*VLKVHFNLF 464 ++K SYL +YF F YA++ Y + F+LF Sbjct: 395 VHKNNNSYLDQYFLDFDYARDAFSYFKAIWAEFSLF 430 >SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1297 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 362 QN*TFLFTKILLSLHLCAEYDI 427 +N FLFT ILL +LC + D+ Sbjct: 777 RNQPFLFTNILLRFYLCLKDDV 798 >SPAC3A11.05c |kms1||meiotic spindle pole body protein Kms1|Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 25.8 bits (54), Expect = 6.0 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 532 FHI*FSLYIFYSKDKVIIKSLLQNRLKCTFSTYEYNII 419 F++ F FY D ++ LLQ L+ F+ E+ II Sbjct: 558 FYVLFLFACFYGLDYILCAELLQAFLRVVFTFCEHIII 595 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,450,179 Number of Sequences: 5004 Number of extensions: 43781 Number of successful extensions: 67 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -