BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0478 (701 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45722| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23132| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_20364| Best HMM Match : Thyroglobulin_1 (HMM E-Value=1.8e-16) 36 0.042 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.097 SB_56344| Best HMM Match : Kazal_2 (HMM E-Value=1.5e-09) 34 0.097 SB_27392| Best HMM Match : Kazal_1 (HMM E-Value=0.00072) 31 0.68 SB_59779| Best HMM Match : Thyroglobulin_1 (HMM E-Value=1.2e-26) 28 8.4 >SB_45722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1080 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 2/70 (2%) Frame = +1 Query: 13 IWKWCDLDAQTNDRFVSRHELFPIRAPLMALEHCIAPFLDRCDADDDHRVTLAEWGKCL- 189 +W++ + DA ND+ + HE +++ + E C+ F+D CD D +T EW C Sbjct: 727 MWEFDNQDANRNDQ-LDEHE---VKSMIDLREPCMVGFMDACDFDGHPGITRHEWNACFP 782 Query: 190 -ELDELEMEE 216 L+ LE+ + Sbjct: 783 TRLEVLEVSQ 792 >SB_23132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +1 Query: 16 WKWCDLDAQTNDRFVSRHELFPIRAPLMALEHCIAPFLDRCDADDDHRVTLAEWGKC 186 W++ + DA ND+ + HE +++ + E C+ F+D CD D +T EW C Sbjct: 1 WEFDNQDANRNDQ-LDEHE---VKSMIDLREPCMVGFMDACDFDGHPGITRHEWNAC 53 >SB_20364| Best HMM Match : Thyroglobulin_1 (HMM E-Value=1.8e-16) Length = 187 Score = 35.5 bits (78), Expect = 0.042 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 3/71 (4%) Frame = +1 Query: 4 HEAIWKWCDLDAQTNDRFVSRHELFP-IRAPLMAL--EHCIAPFLDRCDADDDHRVTLAE 174 H +WK+ LD D F+ EL +R A+ + C F+ CD + D R++ E Sbjct: 47 HLLMWKFNQLDTNA-DYFLEWSELHGFLRMSKKAIHPKKCSKTFVGYCDENQDQRISRNE 105 Query: 175 WGKCLELDELE 207 W C + E++ Sbjct: 106 WYACFGVQEIK 116 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 34.3 bits (75), Expect = 0.097 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 5/63 (7%) Frame = +1 Query: 16 WKWCDLDAQTNDRFVSRHELFPIRAPLMALE-----HCIAPFLDRCDADDDHRVTLAEWG 180 WK+ LD+ DR ++ E F + M + C L CD D D+ ++L EW Sbjct: 373 WKFHQLDSN-RDRIINSREFFVVSMKKMLGKIKRGRKCSRKLLADCDFDKDNGLSLNEWS 431 Query: 181 KCL 189 CL Sbjct: 432 YCL 434 >SB_56344| Best HMM Match : Kazal_2 (HMM E-Value=1.5e-09) Length = 217 Score = 34.3 bits (75), Expect = 0.097 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = +1 Query: 10 AIWKW-CDLDAQTNDRFVSRHELFPIRAPLMALEHCIAPFLDRCDADDDHRVTLAEWGKC 186 AI KW D + D + E+ I A +M E C A FL CD + ++ +EW C Sbjct: 144 AIAKWEFDRNDLDKDNALEGAEIDNILA-MMIYEPCAAGFLWSCDLNRKQGISRSEWDMC 202 Query: 187 LELDELEMEER 219 L E E R Sbjct: 203 FTLAEREFPLR 213 >SB_27392| Best HMM Match : Kazal_1 (HMM E-Value=0.00072) Length = 196 Score = 31.5 bits (68), Expect = 0.68 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +1 Query: 10 AIWKWCDLDAQTNDRFVSRHELFPIRAPLMALEHCIAPFLDRCDADDDHRVTLAEWGKC 186 A W++ +D D +S E+ I PL+ E CI F+ CD + + + EW C Sbjct: 122 AQWEFDRVDFN-RDGVLSGREINSIIGPLLFHERCIYGFVMSCDVNKNSVIDKQEWLLC 179 >SB_59779| Best HMM Match : Thyroglobulin_1 (HMM E-Value=1.2e-26) Length = 452 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 106 EHCIAPFLDRCDADDDHRVTLAEWGKCLEL 195 E+CI F ++CDA D + +L E +L Sbjct: 53 ENCITQFFEKCDATKDGQFSLLESANASQL 82 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,510,237 Number of Sequences: 59808 Number of extensions: 289485 Number of successful extensions: 520 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -