BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0478 (701 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08580.1 68418.m01021 calcium-binding EF hand family protein ... 29 2.3 At4g20910.1 68417.m03031 double-stranded RNA binding protein-rel... 27 9.1 >At5g08580.1 68418.m01021 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 391 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 5/50 (10%) Frame = +1 Query: 40 QTNDRFVSRHELFPIRAPLMALEHCIAP-----FLDRCDADDDHRVTLAE 174 + +D ++S EL PI + + EH A + + D+D D R+TLAE Sbjct: 313 KNDDGYLSDVELLPIISKIHPTEHYYAKQQADYIISQADSDKDRRLTLAE 362 >At4g20910.1 68417.m03031 double-stranded RNA binding protein-related / DsRBD protein-related contains weak similarity to Pfam profile PF00035: Double-stranded RNA binding motif Length = 942 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +1 Query: 151 DHRVTLAEWGKCLELDELEMEERCDDFNENAEHYFSAPMMLQAPPSY 291 D R+ + G CLE+ E E++ +F E F +++ + P+Y Sbjct: 783 DSRLHDVDIGTCLEVIEHMEEDQACEFGEKVLSLFHPKLLIVSTPNY 829 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,437,275 Number of Sequences: 28952 Number of extensions: 210840 Number of successful extensions: 371 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 371 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -